LOCUS X73487 2349 bp DNA linear VRL 14-NOV-2006
DEFINITION Adenovirus type 12 DNA, complete genome.
ACCESSION X73487 REGION: 22695..25043
VERSION X73487.1 GI:313361
KEYWORDS complete genome; core protein; DNA polymerase; DNA-binding protein;
 endoprotease; fiber protein; hexon protein; large T-antigen;
 maturation protein; minor core protein; penton protein;
 peripentonal hexon-associated protein; promoter; repeat region;
 small t-antigen; transcriptional activation.
SOURCE Human adenovirus 12
 ORGANISM Human adenovirus 12
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1
 AUTHORS Kimura,T., Sawada,Y., Shinawawa,M., Shimizu,Y., Shiroki,K.,
 Shimojo,H., Sugisaki,H., Takanami,M., Uemizu,Y. and Fujinaga,K.
 TITLE Nucleotide sequence of the transforming early region E1b of
 adenovirus type 12 DNA: structure and gene organization, and
 comparison with those of adenovirus type 5 DNA
 JOURNAL Nucleic Acids Res. 9 (23), 6571-6589 (1981)
 PUBMED 6275367
 REMARK (sites)
REFERENCE 2 (bases 1640 to 2009)
 AUTHORS Engler,J.A. and van Bree,M.P.
 TITLE The nucleotide sequence of the gene encoding protein IVa2 in human
 adenovirus type 7
 JOURNAL Gene 19 (1), 71-80 (1982)
 PUBMED 6292051
REFERENCE 3 (bases 1 to 272)
 AUTHORS Kruijer,W., van Schaik,F.M., Speijer,J.G. and Sussenbach,J.S.
 TITLE Structure and function of adenovirus DNA binding protein:
 comparison of the amino acid sequences of the Ad5 and Ad12 proteins
 derived from the nucleotide sequence of the corresponding genes
 JOURNAL Virology 128 (1), 140-153 (1983)
 PUBMED 6308889
REFERENCE 4
 AUTHORS Juttermann,R., Weyer,U. and Doerfler,W.
 TITLE Defect of adenovirus type 12 replication in hamster cells: absence
 of transcription of viral virus-associated and L1 RNAs
  JOURNAL J. Virol. 63 (8), 3535-3540 (1989)
 PUBMED 2746738
 REMARK (sites)
REFERENCE 5
 AUTHORS Zock,C., Iselt,A. and Doerfler,W.
 TITLE A unique mitigator sequence determines the species specificity of
 the major late promoter in adenovirus type 12 DNA
 JOURNAL J. Virol. 67 (2), 682-693 (1993)
 PUBMED 8419643
 REMARK (sites)
REFERENCE 6
 AUTHORS Sprengel,J., Schmitz,B., Heuss-Neitzel,D., Zock,C. and Doerfler,W.
 TITLE Nucleotide sequence of human adenovirus type 12 DNA: comparative
 functional analysis
 JOURNAL J. Virol. 68 (1), 379-389 (1994)
 PUBMED 8254750
REFERENCE 7 (bases 1 to 2349)
 AUTHORS Sprengel,J.
 TITLE Direct Submission
 JOURNAL Submitted (21-JUN-1993) J. Sprengel, Institute of Genetics/Dept.
 Virology, Weyertal 121, 50931 Cologne 41, FRG
FEATURES Location/Qualifiers
 source 1..2349
 /organism="Human adenovirus 12"
  /mol_type="genomic DNA"
 /db_xref="taxon:28282"
 CDS 1..2349
 /note="unnamed protein product; late 100 KD protein;
 homologue to crossref SWISS-PROT:L100_ADE02, L100_ADE05,
 L100_ADE41"
 /codon_start=1
 /protein_id="CAA51894.1"
 /db_xref="GI:313379"
 /db_xref="GOA:P36714"
 /db_xref="InterPro:IPR003381"
 /db_xref="UniProtKB/Swiss-Prot:P36714"
 /translation="MMDLEPQESLTAPTAPAIGATAVMEKDKSLLIPQDAPVEQNLGY
  ETPPEEFEGFLQIQKQPNEQNAGLEDHDYLNEGDVLFKHLQRQSTIVRDAISDRSSIP
 VSIAELSCIYERNLFSPRVPPKRQANGTCEPNPRLNFYPVFAVPEALATYHIFFKNHK
 IPLSCRANRSRADELLALRAGASIPGIVSLEEVPKIFEGLGRDEKRAANALQKENEQN
 HHGNSALIELEGDNARLAVLKRNIEVTHFAYPAVNLPPKVMSAVMNQLLIKRAQPIDK
 DANLQDPEATDDGKPVVSDEQLTKWLGTDNSNELQQRRKLMMAAVLVTVELECMHRFF
 SDITTLRKIEECLHYTFRHGYVRQACKISNVELSNLVSYMGILHENRLGQNVLHSTLR
 DEARRDYVRDCIYLFLLHTWQTGMGVWQQCLEEKNLRELNKLLDRALKSLWTGFDERT
 VAAELADIIFPERLMITLQNGLPDFMSQSMLHNYRSFILERSGMLPSMCCALPSDFVP
 IYFRECPPPLWSHCYLLRLANYLAYHSDLMTDSSGEGLMECHCRCNLCTPHRSLVCNT
 ELLSESQVIGTFEMQGPQSDSNFTTNLRLTPGLWTSAYLRKFEPQDYHAHSINFYEDQ
 SKPPKAPLTACVITQGKILAQLHAIKQAREEFLLKKGHGVYLDPQTGEELNLPSPLCA
 TASPHSQHVPESRKTGYCAATLKETAATAGNLGGRILGESGRGRGRGLGRMGGGGGGQ
 PRRGSRGGGGRFQGRSDRRQTVAFNQALSNETRCEQISESQP"
 misc_feature 233..535
 /note="11.2K urf"
 variation 1763
 /citation=[2]
 /replace="c"
 variation 1842
 /citation=[2]
 /replace="a"
 misc_feature complement(2094..>2349)
 /note="14.6K urf"
ORIGIN 
 1 atgatggatc tggagccaca ggaaagctta accgccccca ccgctcccgc cattggcgct
 61 acggctgtca tggagaagga caaaagtcta ctcatacccc aagacgcacc ggttgagcag
 121 aacttgggct acgagactcc ccccgaggaa tttgaaggct ttcttcaaat ccaaaagcaa
 181 ccaaatgagc aaaacgctgg gctcgaggac catgactacc taaacgaggg agatgtcctg
 241 tttaaacatc tacagcgaca aagcactatc gttcgcgacg ccatatctga tcgctcttca
 301 ataccagttt caattgcaga actatcttgc atctacgaac gcaacctgtt ctccccacgt
 361 gtgcccccta aacggcaagc caacggcaca tgcgagccaa atcctcgcct taacttctac
 421 ccagtttttg cagtgccaga agcactggca acataccata ttttctttaa aaatcacaaa
 481 atacccctat cctgtcgagc taaccgcagc cgcgcagatg agcttcttgc tttaagggct
 541 ggcgcttcca tacctgggat tgtgtccttg gaagaggtgc ctaaaatttt tgaaggttta
 601 ggtcgggatg aaaaacgagc agcaaatgcc ctgcaaaaag aaaatgaaca aaatcaccat
 661 gggaatagtg ctctaataga actggaaggt gacaatgccc gcctggcagt tttaaagcgc
 721 aatattgagg ttactcactt tgcctacccg gcagtaaatc ttccgccaaa ggtaatgagc
  781 gcagtgatga atcagctact aattaagcga gcccaaccca ttgacaaaga tgcaaacttg
 841 caagacccgg aggcaacaga tgatggaaag ccggttgtaa gcgacgagca attaactaag
 901 tggttgggaa cagacaattc caacgaacta caacagcggc gtaaactcat gatggccgcc
 961 gtacttgtaa ctgtggaact cgagtgcatg catcgttttt tctccgacat caccacattg
 1021 cgcaaaattg aggaatgtct tcactacact ttccgccatg gctacgtgcg ccaagcctgt
 1081 aaaatttcta atgtggagct gagcaatcta gtttcttaca tgggcatctt gcatgaaaac
 1141 cgattgggac agaacgtgct acactcaaca ctacgcgatg aagcacgcag agattacgtg
 1201 cgagactgca tttacctttt cctgttacat acctggcaaa ctgggatggg tgtttggcag
 1261 caatgcttgg aagaaaaaaa ccttcgagaa ctaaacaaac tgttagacag agcactaaaa
 1321 tccctatgga ccggttttga cgaacggaca gtagctgcag agctagctga cataattttc
 1381 ccagaaaggt taatgataac cttgcaaaac ggcttgcctg actttatgag tcaaagtatg
 1441 ctgcacaatt atcgctcttt tatattagag cgttctggga tgcttcctag catgtgttgt
 1501 gcacttcctt cagattttgt gcctatatat tttagagagt gcccccctcc cctgtggagc
 1561 cactgctact tactacgact tgctaactac ctagcttacc actcagacct tatgacagat
 1621 tcaagcggcg aaggcctaat ggagtgtcac tgccgctgca atctttgcac cccccaccgt
 1681 tctttggttt gcaatactga actattaagt gaaagtcaag tcattggtac cttcgaaatg
 1741 cagggaccgc agtctgacag caatttcacg acgaacctaa gacttacccc tgggctttgg
 1801 acttctgcct acctgcgcaa atttgaaccc caagattacc acgcccacag tatcaatttt
 1861 tacgaagacc aatccaaacc cccaaaagcg ccactaacgg cttgcgtcat tacgcaggga
 1921 aaaattctag cccaattgca tgctattaag caagcgcgcg aagagttttt acttaaaaaa
 1981 ggacacggag tgtaccttga tccccaaacc ggcgaggaac taaaccttcc atcacctttg
 2041 tgtgctactg cgtctcccca ttcgcagcat gtccccgaaa gccgcaaaac aggctattgc
 2101 gcagcaacgc tcaaagaaac agcagcaacg gcaggaaatc tgggaggaag aatcttggga
 2161 gagtcaggca gaggacgagg tcgaggactt ggaagaatgg gaggaggagg aggcggacag
 2221 cctagacgag gatccagagg aggaggagga aggttccaag gacggagcga ccgccgccaa
 2281 accgtcgctt tcaaccaagc cctctccaat gaaacccgct gtgagcaaat ctcagaaagc
 2341 caaccgtag
//