LOCUS X73487 1494 bp DNA linear VRL 14-NOV-2006
DEFINITION Adenovirus type 12 DNA, complete genome.
ACCESSION X73487 REGION: 13394..14887
VERSION  X73487.1 GI:313361
KEYWORDS complete genome; core protein; DNA polymerase; DNA-binding protein;
 endoprotease; fiber protein; hexon protein; large T-antigen;
 maturation protein; minor core protein; penton protein;
 peripentonal hexon-associated protein; promoter; repeat region;
 small t-antigen; transcriptional activation.
SOURCE Human adenovirus 12
 ORGANISM Human adenovirus 12
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1
 AUTHORS Kimura,T., Sawada,Y., Shinawawa,M., Shimizu,Y., Shiroki,K.,
 Shimojo,H., Sugisaki,H., Takanami,M., Uemizu,Y. and Fujinaga,K.
 TITLE Nucleotide sequence of the transforming early region E1b of
 adenovirus type 12 DNA: structure and gene organization, and
 comparison with those of adenovirus type 5 DNA
 JOURNAL Nucleic Acids Res. 9 (23), 6571-6589 (1981)
 PUBMED 6275367
 REMARK (sites)
REFERENCE 2
 AUTHORS Juttermann,R., Weyer,U. and Doerfler,W.
 TITLE Defect of adenovirus type 12 replication in hamster cells: absence
 of transcription of viral virus-associated and L1 RNAs
 JOURNAL J. Virol. 63 (8), 3535-3540 (1989)
 PUBMED 2746738
 REMARK (sites)
REFERENCE 3
 AUTHORS Zock,C., Iselt,A. and Doerfler,W.
 TITLE A unique mitigator sequence determines the species specificity of
 the major late promoter in adenovirus type 12 DNA
 JOURNAL J. Virol. 67 (2), 682-693 (1993)
 PUBMED 8419643
 REMARK (sites)
REFERENCE 4
 AUTHORS Sprengel,J., Schmitz,B., Heuss-Neitzel,D., Zock,C. and Doerfler,W.
 TITLE Nucleotide sequence of human adenovirus type 12 DNA: comparative
 functional analysis
 JOURNAL J. Virol. 68 (1), 379-389 (1994)
 PUBMED 8254750
REFERENCE 5 (bases 1 to 1494)
 AUTHORS Sprengel,J.
 TITLE Direct Submission
 JOURNAL Submitted (21-JUN-1993) J. Sprengel, Institute of Genetics/Dept.
 Virology, Weyertal 121, 50931 Cologne 41, FRG
FEATURES  Location/Qualifiers
 source 1..1494
 /organism="Human adenovirus 12"
 /mol_type="genomic DNA"
 /db_xref="taxon:28282"
 CDS 1..1494
 /note="penton protein (virion component III); homologue to
 crossref SWISS-PROT:PEN3_ADE02, PEN3_ADE05"
 /codon_start=1
  /product="penton protein"
 /protein_id="CAA51887.1"
 /db_xref="GI:313372"
 /db_xref="GOA:P36716"
  /db_xref="InterPro:IPR002605"
 /db_xref="UniProtKB/Swiss-Prot:P36716"
 /translation="MRRAVELQTVAFPETPPPSYETVMAAAPPYVPPRYLGPTEGRNS
 IRYSELSPLYDTTRVYLVDNKSSDIASLNYQNDHSNFLTTVVQNNDYSPIEAGTQTIN
 FDERSRWGGDLKTILHTNMPNVNDFMFTTKFKARVMVARKTNNEGQTILEYEWAEFVL
 PEGNYSETMTIDLMNNAIIEHYLRVGRQHGVLESDIGVKFDTRNFRLGWDPETQLVTP
 GVYTNEAFHPDIVLLPGCGVDFTESRLSNILGIRKRQPFQEGFVIMYEHLEGGNIPAL
 LDVKKYENSLQDQNTVRGDNFIALNKAARIEPVETDPKGRSYNLLPDKKNTKYRSWYL
 AYNYGDPEKGVRSWTLLTTPDVTGGSEQVYWSLPDMMQDPVTFRSSRQVSNYPVVAAE
 LLPVHAKSFYNEQAVYSQLIRQSTALTRVFNRFPENQILVRPPAATITTVSENVPALT
 DHGTLPLRSSISGVQRVTITDARRRTCPYVYKALGIVSPRVLSSRTF"
ORIGIN 
 1 atgaggcgcg cggtggaact gcagacagtg gcttttcctg agacaccacc tccctcttac
  61 gaaaccgtga tggcagcggc gccaccctac gtgcctcccc gctatttggg tcctacggag
 121 ggaagaaaca gtatccgtta ctcggaattg tcaccgttgt acgataccac tcgagtgtac
 181 ttggtggaca acaagtcttc tgacattgct tcattgaatt accagaatga tcacagcaac
 241 tttttaacca ctgtagtgca aaataatgac tattccccta tagaggctgg cacgcaaact
 301 attaactttg atgaaaggtc tagatggggt ggagatttaa aaaccatctt acataccaac
 361 atgccaaacg tgaacgattt tatgtttacc accaaattta aggccagggt aatggtggct
 421 aggaaaacaa acaacgaagg ccaaaccatt ttagaatatg agtgggcaga atttgtgcta
 481 cccgagggta actattcgga aaccatgact attgacttaa tgaacaatgc tattattgag
 541 cattatttgc gagtaggaag acagcatgga gtgctggaaa gtgacattgg agttaagttt
 601 gacaccagaa actttcgtct gggttgggac cccgaaaccc aattagtaac tccgggagtg
 661 tacactaatg aggcttttca tccagatata gtactgcttc caggttgcgg ggttgatttt
 721 acagagagca gattaagcaa catactaggt ataagaaaga ggcagccgtt tcaggaagga
 781 tttgtgatta tgtatgaaca cttagaggga ggcaatattc cagctctttt ggatgtaaaa
 841 aaatacgaaa acagtctgca ggatcaaaac actgtaagag gagacaactt tattgcctta
 901 aataaggctg ctaggattga accggttgaa acagacccca aaggacgcag ttacaacttg
 961 cttccagaca aaaaaaatac taaatatcgc agctggtatt tggcatacaa ctacggagac
 1021 ccagaaaaag gagttcggtc atggactcta ctaacaactc cagatgtaac aggcggctcc
 1081 gaacaggtgt actggtccct acccgatatg atgcaagatc cggtgacttt tcgctcctcg
 1141 cgtcaagtta gcaactatcc tgtagttgca gcagaattac tgccagttca tgctaaaagc
 1201 ttctacaacg agcaagccgt ctactcacag cttattcgcc agtcaaccgc gcttacgcgc
 1261 gtgtttaatc gctttcccga gaaccagata ctggtgcgtc caccagccgc taccatcact
 1321 accgtcagtg aaaacgttcc cgcccttaca gatcacggga ccctgccgct gcgtagcagt
 1381 atcagtggag ttcagcgagt caccatcact gacgcccgcc gccggacctg tccctacgtt
 1441 tacaaagcac tgggcatagt ttctccacga gtgctttcta gtcgcacttt ttaa
//