LOCUS       X73487                   621 bp    DNA     linear   VRL 14-NOV-2006
DEFINITION  Adenovirus type 12 DNA, complete genome.
ACCESSION   X73487 REGION: 20525..21145
VERSION     X73487.1  GI:313361
KEYWORDS    complete genome; core protein; DNA polymerase; DNA-binding protein;
            endoprotease; fiber protein; hexon protein; large T-antigen;
            maturation protein; minor core protein; penton protein;
            peripentonal hexon-associated protein; promoter; repeat region;
            small t-antigen; transcriptional activation.
SOURCE      Human adenovirus 12
  ORGANISM  Human adenovirus 12
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE   1
  AUTHORS   Kimura,T., Sawada,Y., Shinawawa,M., Shimizu,Y., Shiroki,K.,
            Shimojo,H., Sugisaki,H., Takanami,M., Uemizu,Y. and Fujinaga,K.
  TITLE     Nucleotide sequence of the transforming early region E1b of
            adenovirus type 12 DNA: structure and gene organization, and
            comparison with those of adenovirus type 5 DNA
  JOURNAL   Nucleic Acids Res. 9 (23), 6571-6589 (1981)
   PUBMED   6275367
  REMARK    (sites)
REFERENCE   2  (bases 442 to 621)
  AUTHORS   Kruijer,W., van Schaik,F.M., Speijer,J.G. and Sussenbach,J.S.
  TITLE     Structure and function of adenovirus DNA binding protein:
            comparison of the amino acid sequences of the Ad5 and Ad12 proteins
            derived from the nucleotide sequence of the corresponding genes
  JOURNAL   Virology 128 (1), 140-153 (1983)
   PUBMED   6308889
REFERENCE   3
  AUTHORS   Juttermann,R., Weyer,U. and Doerfler,W.
  TITLE     Defect of adenovirus type 12 replication in hamster cells: absence
            of transcription of viral virus-associated and L1 RNAs
  JOURNAL   J. Virol. 63 (8), 3535-3540 (1989)
   PUBMED   2746738
  REMARK    (sites)
REFERENCE   4
  AUTHORS   Zock,C., Iselt,A. and Doerfler,W.
  TITLE     A unique mitigator sequence determines the species specificity of
            the major late promoter in adenovirus type 12 DNA
  JOURNAL   J. Virol. 67 (2), 682-693 (1993)
   PUBMED   8419643
  REMARK    (sites)
REFERENCE   5
  AUTHORS   Sprengel,J., Schmitz,B., Heuss-Neitzel,D., Zock,C. and Doerfler,W.
  TITLE     Nucleotide sequence of human adenovirus type 12 DNA: comparative
            functional analysis
  JOURNAL   J. Virol. 68 (1), 379-389 (1994)
   PUBMED   8254750
REFERENCE   6  (bases 1 to 621)
  AUTHORS   Sprengel,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-1993) J. Sprengel, Institute of Genetics/Dept.
            Virology, Weyertal 121, 50931 Cologne 41, FRG
FEATURES             Location/Qualifiers
     source          1..621
                     /organism="Human adenovirus 12"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:28282"
     CDS             1..621
                     /note="crossref SWISS-PROT:VPRT_ADE12, P09569"
                     /codon_start=1
                     /product="virus encoded endoprotease (Late protein 3)"
                     /protein_id="CAA51892.1"
                     /db_xref="GI:313377"
                     /db_xref="GOA:P09569"
                     /db_xref="InterPro:IPR000855"
                     /db_xref="UniProtKB/Swiss-Prot:P09569"
                     /translation="MGSSEQELTAIVRDLGCGPYFLGTFDKRFPGFVSRDRLSCAIVN
                     TAGRETGGVHWLAFGWNPKSHTCYLFDPFGFSDQRLKQIYQFEYESLLRRSALAATKD
                     RCVTLEKSTQTVQGPFSAACGLFCCMFLHAFTHWPDHPMDKNPTMDLLTGVPNCMLQS
                     PQVVGTLQRNQNELYKFLNNLSPYFRHNRERIEKATSFTKMQNGLK"
ORIGIN      
        1 atgggttcaa gcgaacagga gctgacggcc attgttcgag atctaggctg tggaccctat
       61 tttttgggaa cctttgacaa acgttttccg ggttttgtgt ctcgcgaccg cttatcatgt
      121 gctattgtta acactgccgg tcgcgaaact gggggcgtac actggctggc ttttggatgg
      181 aaccccaaat cgcacacttg ctatttattc gatccatttg gattttctga tcaacgacta
      241 aaacaaatct atcagtttga gtacgaaagt ctgttgcgcc gtagtgcgct agcggccact
      301 aaagaccgat gcgttaccct agaaaagtca acccaaactg tacaaggacc gttttctgca
      361 gcgtgcggcc tgttttgttg tatgttctta cacgctttta ctcactggcc tgaccatcca
      421 atggataaaa atcccactat ggacctactt actggggtgc ctaattgtat gctacaaagt
      481 cctcaggtag tgggcacatt gcaacgcaat cagaatgaat tgtataaatt cttaaacaat
      541 ctgtcccctt actttcgtca caaccgcgag cgcatagaaa aagctacatc ttttactaaa
      601 atgcaaaatg gactcaaata a
//