LOCUS X73487 1122 bp DNA linear VRL 14-NOV-2006
DEFINITION Adenovirus type 12 DNA, complete genome.
ACCESSION X73487 REGION: 10428..11549
VERSION X73487.1 GI:313361
KEYWORDS complete genome; core protein; DNA polymerase; DNA-binding protein;
 endoprotease; fiber protein; hexon protein; large T-antigen;
 maturation protein; minor core protein; penton protein;
 peripentonal hexon-associated protein; promoter; repeat region;
 small t-antigen; transcriptional activation.
SOURCE Human adenovirus 12
 ORGANISM Human adenovirus 12
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1
 AUTHORS Kimura,T., Sawada,Y., Shinawawa,M., Shimizu,Y., Shiroki,K.,
 Shimojo,H., Sugisaki,H., Takanami,M., Uemizu,Y. and Fujinaga,K.
 TITLE Nucleotide sequence of the transforming early region E1b of
 adenovirus type 12 DNA: structure and gene organization, and
 comparison with those of adenovirus type 5 DNA
 JOURNAL Nucleic Acids Res. 9 (23), 6571-6589 (1981)
 PUBMED 6275367
 REMARK (sites)
REFERENCE 2 (bases 1 to 43)
 AUTHORS Shu,L.M., Hong,J.S., Wei,Y.F. and Engler,J.A.
 TITLE Nucleotide sequence of the genes encoded in early region 2b of
 human adenovirus type 12
 JOURNAL Gene 46 (2-3), 187-195 (1986)
 PUBMED 3803925
REFERENCE 3
 AUTHORS Juttermann,R., Weyer,U. and Doerfler,W.
 TITLE Defect of adenovirus type 12 replication in hamster cells: absence
  of transcription of viral virus-associated and L1 RNAs
 JOURNAL J. Virol. 63 (8), 3535-3540 (1989)
 PUBMED 2746738
 REMARK (sites)
REFERENCE 4
 AUTHORS Zock,C., Iselt,A. and Doerfler,W.
 TITLE A unique mitigator sequence determines the species specificity of
 the major late promoter in adenovirus type 12 DNA
 JOURNAL J. Virol. 67 (2), 682-693 (1993)
 PUBMED 8419643
 REMARK (sites)
REFERENCE 5
 AUTHORS Sprengel,J., Schmitz,B., Heuss-Neitzel,D., Zock,C. and Doerfler,W.
 TITLE Nucleotide sequence of human adenovirus type 12 DNA: comparative
 functional analysis
 JOURNAL J. Virol. 68 (1), 379-389 (1994)
 PUBMED 8254750
REFERENCE 6 (bases 1 to 1122)
 AUTHORS Sprengel,J.
 TITLE Direct Submission
 JOURNAL Submitted (21-JUN-1993) J. Sprengel, Institute of Genetics/Dept.
 Virology, Weyertal 121, 50931 Cologne 41, FRG
FEATURES Location/Qualifiers
 source 1..1122
 /organism="Human adenovirus 12"
 /mol_type="genomic DNA"
 /db_xref="taxon:28282"
 CDS 1..1122
 /note="late 52 KD protein; homologue to crossref
 SWISS-PROT:L52_ADE02, L52_ADE05"
 /codon_start=1
 /product="52 KD protein"
 /protein_id="CAA51885.1"
 /db_xref="GI:313370"
 /db_xref="GOA:P36715"
 /db_xref="InterPro:IPR004292"
 /db_xref="UniProtKB/Swiss-Prot:P36715"
 /translation="MHPVLRQMRPQPRATTASAAVALSGSGEQEEPQCPTLELEEGEG
 IARLGAHSPERHPRVQLARDSRVAFVPRQNMFRDNSGEEAEEMRDCRFRAGRELRRGF
 NRERLLREEDFEPDEHSGISSARAHVSAANLVTAYEQTVTEERNFQKSFNNHVRTLIA
 REEVAIGLMHLWDFVEAYVHNPASKPLTAQLFLIVQHSRDNETFRDAMLNIAEPQGRW
 LLDLINILQSIVVQERSLSLADKVAAINYSMLSLGKFYARKIYKSPYVPIDKEVKIDS
 FYMRMALKVLTLSDDLGVYRNDRIHKAVSASRRRELSDKELMHSLQRALTGAGTEDES
 FFDMGADLRWQPSARALEAAGVASADVTGDDDDEDQYED"
 misc_feature complement(52..381)
 /note="12.4K urf"
ORIGIN 
 1 atgcatcctg tcctgcgaca aatgcgacct cagcccaggg caaccacggc ctcagcagcg
 61 gtggcgcttt cgggctctgg cgaacaggaa gagcctcaat gtcctacatt ggagttggaa
 121 gaaggagaag gcatagcccg attgggcgcc cactctcctg agcgtcaccc aagggtgcag
 181 ctcgcccggg acagtcgcgt ggcatttgtg cctcgtcaga acatgtttcg cgacaacagc
 241 ggggaggaag ctgaggaaat gcgagactgc aggtttaggg ccggtcgcga gctgcgccgc
 301 ggatttaatc gcgagcgact gctgcgtgag gaggactttg agccagatga acattcgggg
 361 attagttctg cacgggccca tgtatcagca gccaacttag taacagcata tgaacaaacg
 421 gttacagagg aacgtaactt tcaaaaaagc tttaataacc atgtgcgcac actaatagcg
 481 cgagaagaag tagccattgg tttaatgcat ctttgggact ttgtagaagc ttatgtacat
 541 aatccagcaa gtaaacccct aactgcccag ctgttcttaa tagttcaaca tagtagagac
 601 aatgaaactt ttagggatgc aatgcttaac atagctgaac cccagggtcg gtggttactc
 661 gatttaatta acattctgca gagcattgtg gttcaggaac gcagtcttag tttggcagac
 721 aaggtggccg ccattaatta ctccatgtta agtttgggaa agttttatgc tcgtaaaatc
 781 tacaaaagtc cgtatgttcc cattgacaag gaagtgaaga tagacagctt ttatatgcgc
 841 atggctttaa aggtactaac attaagcgac gatcttggag tgtaccgcaa tgaccgaatc
 901 cacaaagcag taagcgccag tcgccgcaga gagctaagcg acaaagagct tatgcatagc
 961 ttacaaaggg cgctgacggg agcaggaaca gaggacgagt cgttctttga tatgggcgca
 1021 gacctacggt ggcagccaag cgctcgcgct ttggaggcag ctggagtggc gtctgctgac
 1081 gtcactggcg atgacgatga cgaagaccag tacgaggact ga
//