LOCUS       X73487                  1455 bp    DNA     linear   VRL 14-NOV-2006
DEFINITION  Adenovirus type 12 DNA, complete genome.
ACCESSION   X73487 REGION: 21215..22669
VERSION     X73487.1  GI:313361
KEYWORDS    complete genome; core protein; DNA polymerase; DNA-binding protein;
            endoprotease; fiber protein; hexon protein; large T-antigen;
            maturation protein; minor core protein; penton protein;
            peripentonal hexon-associated protein; promoter; repeat region;
            small t-antigen; transcriptional activation.
SOURCE      Human adenovirus 12
  ORGANISM  Human adenovirus 12
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE   1
  AUTHORS   Kimura,T., Sawada,Y., Shinawawa,M., Shimizu,Y., Shiroki,K.,
            Shimojo,H., Sugisaki,H., Takanami,M., Uemizu,Y. and Fujinaga,K.
  TITLE     Nucleotide sequence of the transforming early region E1b of
            adenovirus type 12 DNA: structure and gene organization, and
            comparison with those of adenovirus type 5 DNA
  JOURNAL   Nucleic Acids Res. 9 (23), 6571-6589 (1981)
   PUBMED   6275367
  REMARK    (sites)
REFERENCE   2  (bases 1 to 1455)
  AUTHORS   Kruijer,W., van Schaik,F.M., Speijer,J.G. and Sussenbach,J.S.
  TITLE     Structure and function of adenovirus DNA binding protein:
            comparison of the amino acid sequences of the Ad5 and Ad12 proteins
            derived from the nucleotide sequence of the corresponding genes
  JOURNAL   Virology 128 (1), 140-153 (1983)
   PUBMED   6308889
REFERENCE   3
  AUTHORS   Juttermann,R., Weyer,U. and Doerfler,W.
  TITLE     Defect of adenovirus type 12 replication in hamster cells: absence
            of transcription of viral virus-associated and L1 RNAs
  JOURNAL   J. Virol. 63 (8), 3535-3540 (1989)
   PUBMED   2746738
  REMARK    (sites)
REFERENCE   4
  AUTHORS   Zock,C., Iselt,A. and Doerfler,W.
  TITLE     A unique mitigator sequence determines the species specificity of
            the major late promoter in adenovirus type 12 DNA
  JOURNAL   J. Virol. 67 (2), 682-693 (1993)
   PUBMED   8419643
  REMARK    (sites)
REFERENCE   5
  AUTHORS   Sprengel,J., Schmitz,B., Heuss-Neitzel,D., Zock,C. and Doerfler,W.
  TITLE     Nucleotide sequence of human adenovirus type 12 DNA: comparative
            functional analysis
  JOURNAL   J. Virol. 68 (1), 379-389 (1994)
   PUBMED   8254750
REFERENCE   6  (bases 1 to 1455)
  AUTHORS   Sprengel,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-1993) J. Sprengel, Institute of Genetics/Dept.
            Virology, Weyertal 121, 50931 Cologne 41, FRG
FEATURES             Location/Qualifiers
     source          1..1455
                     /organism="Human adenovirus 12"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:28282"
     CDS             complement(1..1455)
                     /note="crossref SWISS-PROT:DNB2_ADE12, P04498"
                     /codon_start=1
                     /product="early E2A DNA-binding protein"
                     /protein_id="CAA51893.1"
                     /db_xref="GI:313378"
                     /db_xref="GOA:P04498"
                     /db_xref="InterPro:IPR003176"
                     /db_xref="InterPro:IPR005376"
                     /db_xref="UniProtKB/Swiss-Prot:P04498"
                     /translation="MASNQHSQRERTPDRSAQPPPPKMGRYFLDSESEEELEAVPLPP
                     KKKVKKSMAAIPLSPESAEEEEAEPPRAVLGVMGFSMPPVRIMHHADGSQSFQKMETR
                     QVHVLKASAQNSDENEKNVVVVRNPASQPLVSAWEKGMEAMAMLMEKYHVDHDERATF
                     RFLPDQGSVYKKICTTWLNEEKRGLQLTFSSQKTFQELMGRFLQGYMQAYAGVQQNSW
                     EPTGCCVWEHKCTEREGELRCLHGMEMVRKEHLVEMDVTSESGQRALKENPSKAKVAQ
                     NRWGRNVVQIKNDDARCCFHDVGCGNNSFSGKSCGLFYSEGMKAQIAFRQIEAFMLAD
                     YPHMRHGQKRLLMPVRCECLNKQDGLPRMGRQLCKITPFNLSNVDNIDINEVTDPGAL
                     ASIKYPCLLVFQCANPVYRNARGNAGPNCDFKISAPDVMGALQLVRQLWGENFDGSPP
                     RLVIPEFKWHQRLQYRNISLPTNHGDCREEPFDF"
     misc_feature    436..888
                     /note="16.4K urf"
     variation       886
                     /citation=[2]
                     /replace="c"
ORIGIN      
        1 ttaaaaatca aatggctctt cgcgacagtc gccgtggttg gtgggcaggg atatgtttct
       61 gtactgcaaa cgctgatgcc acttgaattc tggaataaca agcctagggg gggagccgtc
      121 aaaattttct ccccacagct ggcgcacaag ttgcagggcg cccataacat caggagcaga
      181 aatcttgaag tcgcaattag ggccagcatt gccgcgcgca ttgcgataaa ctggatttgc
      241 gcactgaaaa accaacaaac acggatactt aatactggct aacgctccag ggtcggttac
      301 ttcgttgata tcaatgttat ccacattgct gaggttaaaa ggagtgattt tacacagttg
      361 acgccccatc cgtggcaggc catcttgctt gtttaaacat tcgcagcgca ctggcataag
      421 gagacgtttt tgcccatgtc gcatgtgagg gtagtcggcc agcataaaag cttcaatttg
      481 cctaaaagct atttgagcct tcattccttc agaataaaac aagccgcagg actttccgga
      541 gaaagaatta ttcccgcagc caacatcatg aaaacagcag cgggcatcgt cgtttttaat
      601 ttgaactaca ttacgccccc agcggttttg cgccaccttg gctttcgagg ggttctcttt
      661 caacgctcgt tgcccacttt cgctggttac atccatttcc accaaatgct ctttgcgcac
      721 catctccatt ccatgcaggc atctaagctc cccttcgcgc tcggtacact tatgctccca
      781 cacgcagcaa ccggtgggtt cccaggaatt ctgttggaca ccggcataag cttgcatata
      841 tccttgcaaa aagcgtccca tgagctcctg aaaggttttt tgggatgaaa aagtcagctg
      901 caaaccgcgc ttttcttcgt tgagccatgt tgtgcatatt ttcttgtaca cgctgccctg
      961 atccggcaaa aaacgaaagg tggcgcgctc gtcgtgatcc acatggtact tttccattag
     1021 catagccatg gcttccatgc ctttttccca agctgaaact aggggctggc ttgccggatt
     1081 gcgaacaaca acaacattct tttcattttc gtcgctgttt tgagcggaag ccttcaaaac
     1141 gtgtacctgc ctggtttcca ttttttgaaa agactgagaa ccgtctgcat gatgcataat
     1201 gcggacgggc ggcatgctga aacccattac tcctaaaact gctcttggtg gttctgcctc
     1261 ttcttcttct gcactctctg gggaaagagg tatcgcagcc atagatttct tgactttttt
     1321 ctttggaggt aaaggcacag cttccagttc ttcttcgctt tcggaatcca gaaagtatct
     1381 gcccattttt ggcggcggcg gctgagcgct gcggtctggg gtgcgctccc tctgtgagtg
     1441 ctgattgctg gccat
//