LOCUS X73487 597 bp DNA linear VRL 14-NOV-2006
DEFINITION Adenovirus type 12 DNA, complete genome.
ACCESSION X73487 REGION: 503..1099
VERSION X73487.1 GI:313361
KEYWORDS complete genome; core protein; DNA polymerase; DNA-binding protein;
 endoprotease; fiber protein; hexon protein; large T-antigen;
 maturation protein; minor core protein; penton protein;
 peripentonal hexon-associated protein; promoter; repeat region;
 small t-antigen; transcriptional activation.
SOURCE Human adenovirus 12
 ORGANISM Human adenovirus 12
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 597)
 AUTHORS Tolun,A., Alestrom,P. and Pettersson,U.
 TITLE Sequence of inverted terminal repetitions from different
 adenoviruses: demonstration of conserved sequences and homology
 between SA7 termini and SV40 DNA
 JOURNAL Cell 17 (3), 705-713 (1979)
 PUBMED 225041
REFERENCE 2 (bases 1 to 597)
 AUTHORS Sugisaki,H., Sugimoto,K., Takanami,M., Shiroki,K., Saito,I.,
 Shimojo,H., Sawada,Y., Uemizu,Y., Uesugi,S. and Fujinaga,K.
 TITLE Structure and gene organization in the transformed Hind III-G
 fragment of Ad12
 JOURNAL Cell 20 (3), 777-786 (1980)
 PUBMED 6251973
REFERENCE 3 (bases 1 to 597)
 AUTHORS Shinagawa,M. and Padmanabhan,R.
 TITLE Comparative sequence analysis of the inverted terminal repetitions
 from different adenoviruses
 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 77 (7), 3831-3835 (1980)
 PUBMED 6253991
REFERENCE 4
 AUTHORS Kimura,T., Sawada,Y., Shinawawa,M., Shimizu,Y., Shiroki,K.,
 Shimojo,H., Sugisaki,H., Takanami,M., Uemizu,Y. and Fujinaga,K.
 TITLE Nucleotide sequence of the transforming early region E1b of
 adenovirus type 12 DNA: structure and gene organization, and
 comparison with those of adenovirus type 5 DNA
 JOURNAL Nucleic Acids Res. 9 (23), 6571-6589 (1981)
 PUBMED 6275367
 REMARK (sites)
REFERENCE 5 (bases 1 to 597)
 AUTHORS van Ormondt,H. and Galibert,F.
 TITLE Nucleotide sequences of adenovirus DNAs
 JOURNAL Curr. Top. Microbiol. Immunol. 110, 73-142 (1984)
 PUBMED 6383725
REFERENCE 6 (bases 1 to 28)
 AUTHORS Shibata,H., Zheng,J.H., Koikeda,S., Masamune,Y. and Nakanishi,Y.
 TITLE Cis- and trans-acting factors for transcription of the adenovirus
 12 E1A gene
 JOURNAL Biochim. Biophys. Acta 1007 (2), 184-191 (1989)
 PUBMED 2522011
REFERENCE 7
 AUTHORS Juttermann,R., Weyer,U. and Doerfler,W.
 TITLE Defect of adenovirus type 12 replication in hamster cells: absence
 of transcription of viral virus-associated and L1 RNAs
 JOURNAL J. Virol. 63 (8), 3535-3540 (1989)
 PUBMED 2746738
 REMARK (sites)
REFERENCE 8
 AUTHORS Zock,C., Iselt,A. and Doerfler,W.
 TITLE A unique mitigator sequence determines the species specificity of
 the major late promoter in adenovirus type 12 DNA
 JOURNAL J. Virol. 67 (2), 682-693 (1993)
 PUBMED 8419643
 REMARK (sites)
REFERENCE 9
 AUTHORS Sprengel,J., Schmitz,B., Heuss-Neitzel,D., Zock,C. and Doerfler,W.
 TITLE Nucleotide sequence of human adenovirus type 12 DNA: comparative
 functional analysis
 JOURNAL J. Virol. 68 (1), 379-389 (1994)
 PUBMED 8254750
REFERENCE 10 (bases 1 to 597)
 AUTHORS Sprengel,J.
 TITLE Direct Submission
 JOURNAL Submitted (21-JUN-1993) J. Sprengel, Institute of Genetics/Dept.
 Virology, Weyertal 121, 50931 Cologne 41, FRG
FEATURES Location/Qualifiers
 source 1..597
  /organism="Human adenovirus 12"
 /mol_type="genomic DNA"
 /db_xref="taxon:28282"
 CDS 1..597
  /note="unnamed protein product; E1A; transcription
 activation; early protein; alternative splicing; crossref
 SWISS-PROT:E1A_ADE12, P03259"
 /codon_start=1
 /protein_id="CAA51877.1"
 /db_xref="GI:313362"
 /db_xref="GOA:P03259"
 /db_xref="UniProtKB/Swiss-Prot:P03259"
 /translation="MRTEMTPLVLSYQEADDILEHLVDNFFNEVPSDDDLYVPSLYEL
 YDLDVESAGEDNNEQAVNEFFPESLILAASEGLFLPEPPVLSPVCEPIGGECMPQLHP
 EDMDLLCYEMGFPCSDSEDEQDENGMAHVSASAAAAAADREREEFQLDHPELPGHNCK
 SCEHHRNSTGNTDLMCSLCYLRAYNMFIYSKCAMGGGR"
 promoter 527..>597
 /note="crossref Ad12 EPD07152"
 /function="E1b promoter region (-499 to +100)"
ORIGIN 
 1 atgagaactg aaatgactcc cttggtcctg tcgtatcagg aagctgacga catattggag
 61 catttggtgg acaacttttt taacgaggta cccagtgatg atgatcttta tgttccgtct
 121 ctttacgaac tgtatgatct tgatgtggag tctgccggtg aagataataa tgaacaggcg
 181 gtgaatgagt tttttcccga atcgcttatt ttagctgcca gtgaggggtt gtttttaccg
 241 gagcctcctg tactttctcc tgtctgtgag cctattgggg gcgaatgtat gccacaactg
 301 caccctgaag atatggattt attgtgctac gagatgggct ttccctgtag cgattcggaa
 361 gacgagcaag acgagaacgg aatggcgcat gtttctgcat ccgcagctgc tgctgccgct
 421 gatagggaac gtgaggagtt tcagttagac catccagagt tgcccggaca caattgtaag
 481 tcctgtgagc accaccggaa tagtactgga aatactgact taatgtgctc tttgtgctat
 541 ctgcgagcct acaacatgtt catttacagt aagtgtgcta tgggaggtgg gaggtga
//