LOCUS X73487 876 bp DNA linear VRL 14-NOV-2006
DEFINITION Adenovirus type 12 DNA, complete genome.
ACCESSION X73487 REGION: 31436..32311
VERSION X73487.1 GI:313361
KEYWORDS complete genome; core protein; DNA polymerase; DNA-binding protein;
 endoprotease; fiber protein; hexon protein; large T-antigen;
 maturation protein; minor core protein; penton protein;
 peripentonal hexon-associated protein; promoter; repeat region;
 small t-antigen; transcriptional activation.
SOURCE Human adenovirus 12
 ORGANISM Human adenovirus 12
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1
 AUTHORS Kimura,T., Sawada,Y., Shinawawa,M., Shimizu,Y., Shiroki,K.,
 Shimojo,H., Sugisaki,H., Takanami,M., Uemizu,Y. and Fujinaga,K.
 TITLE Nucleotide sequence of the transforming early region E1b of
 adenovirus type 12 DNA: structure and gene organization, and
 comparison with those of adenovirus type 5 DNA
 JOURNAL Nucleic Acids Res. 9 (23), 6571-6589 (1981)
 PUBMED 6275367
 REMARK (sites)
REFERENCE 2
 AUTHORS Juttermann,R., Weyer,U. and Doerfler,W.
 TITLE Defect of adenovirus type 12 replication in hamster cells: absence
 of transcription of viral virus-associated and L1 RNAs
 JOURNAL J. Virol. 63 (8), 3535-3540 (1989)
 PUBMED 2746738
 REMARK (sites)
REFERENCE 3
 AUTHORS Zock,C., Iselt,A. and Doerfler,W.
 TITLE A unique mitigator sequence determines the species specificity of
 the major late promoter in adenovirus type 12 DNA
 JOURNAL J. Virol. 67 (2), 682-693 (1993)
 PUBMED 8419643
 REMARK (sites)
REFERENCE 4
 AUTHORS Sprengel,J., Schmitz,B., Heuss-Neitzel,D., Zock,C. and Doerfler,W.
 TITLE Nucleotide sequence of human adenovirus type 12 DNA: comparative
 functional analysis
 JOURNAL J. Virol. 68 (1), 379-389 (1994)
 PUBMED 8254750
REFERENCE 5 (bases 1 to 876)
 AUTHORS Sprengel,J.
 TITLE Direct Submission
 JOURNAL Submitted (21-JUN-1993) J. Sprengel, Institute of Genetics/Dept.
  Virology, Weyertal 121, 50931 Cologne 41, FRG
FEATURES Location/Qualifiers
 source 1..876
 /organism="Human adenovirus 12"
 /mol_type="genomic DNA"
 /db_xref="taxon:28282"
 CDS complement(1..876)
 /note="early E4 34 KD protein; alternative splicing;
 crossref SWISS-PROT:E434_ADE02"
  /codon_start=1
 /product="E4 34 KD protein"
 /protein_id="CAA51901.1"
 /db_xref="GI:313386"
  /db_xref="InterPro:IPR007615"
 /db_xref="UniProtKB/Swiss-Prot:P36710"
 /translation="MQRDRRYRYRLAPYNKYQLPPCEEQSKATLSTSENSLWPECNSL
 TLHNVSEVRGIPSCVGFTVLQEWPIPWDMILTDYEMFILKKYMSVCMCCATINVEVTQ
 LLHGHERWLIHCHCQRPGSLQCMSAGMLLGRWFKMAVYGALINKRCFWYREVVNHLMP
 KEVMYVGSTFVRGRHLIYFKIMYDGHAWLALEKVSFGWSAFNYGILNNMLVLCCDYCK
 DLSEIRMRCCARRTRLLMLKVVQVIAENTVRPLKHSRHERYRQQLLKGLIMHHRAILF
 GDYNQRENPWAADGH"
 CDS complement(809..>876)
 /note="early E4 13 KD protein; alternative splicing;
 crossref SWISS-PROT:E413_ADE02"
 /codon_start=1
 /product="E4 13 KD protein"
 /protein_id="CAA51902.1"
 /db_xref="GI:313387"
 /db_xref="InterPro:IPR008680"
 /db_xref="UniProtKB/Swiss-Prot:P36709"
 /translation="MPLPCIPPPPVSRDTAACIAWLGLAHASCVDTLRFIKHHDLKIT
 PEAEYILASLREWLYFAFLTERQRCKQKGRGAITSGRTWFCFFKYEDARKSVVYDAAR
  QTVSLQIGTIQQVPTTAL"
ORIGIN 
 1 tcagtgtcca tcagccgccc aaggattctc tcgttgatta taatctccaa ataaaattgc
 61 tcgatgatgc ataattaaac cctttagcag ttgctgacga taacgttcat gccgactatg
 121 ttttagaggg cgaacagtgt tttcagcaat tacttgaaca acttttaaca ttagcagtct
 181 ggtacgacga gcgcaacagc gcatgcgtat ctcacttaag tctttacaat aatcacaaca
 241 cagcactaac atgttattta aaattccata attaaaggcg ctccatccaa aactaacttt
 301 ttctaacgct aaccaggcat ggccatcata cataatttta aagtaaatta aatggcgacc
 361 tctaacaaag gtgcttccca catacatcac ctctttaggc attaaatggt taacaacctc
 421 ccgataccaa aaacaccttt tgttaattaa ggcgccatat acggccattt tgaaccagcg
 481 tcccaaaagc atcccagctg acatacactg tagtgaaccc ggacgctggc aatgacaatg
 541 aataagccac cgctcatgac catgtaataa ttgagtaact tcaacattta tagtggcaca
 601 acacatacat acactcatgt attttttcaa aataaacatc tcataatcag ttagaatcat
 661 atcccacggt attggccatt cctgcagcac tgtaaaacct acacatgaag gaatgcctct
 721 tacctcactt acattatgta aagtcagact attacactca ggccataaag aattttccga
 781 agtactcaac gtagcttttg actgttcctc acagggcggt agttggtact tgttgtatgg
 841 tgccaatctg tagcgatacc gtctgtcgcg ctgcat
//