LOCUS X73487 435 bp DNA linear VRL 14-NOV-2006
DEFINITION Adenovirus type 12 DNA, complete genome.
ACCESSION X73487 REGION: 3374..3808
VERSION X73487.1 GI:313361
KEYWORDS complete genome; core protein; DNA polymerase; DNA-binding protein;
 endoprotease; fiber protein; hexon protein; large T-antigen;
 maturation protein; minor core protein; penton protein;
 peripentonal hexon-associated protein; promoter; repeat region;
 small t-antigen; transcriptional activation.
SOURCE Human adenovirus 12
 ORGANISM Human adenovirus 12
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 435)
 AUTHORS Tolun,A., Alestrom,P. and Pettersson,U.
 TITLE Sequence of inverted terminal repetitions from different
 adenoviruses: demonstration of conserved sequences and homology
 between SA7 termini and SV40 DNA
 JOURNAL Cell 17 (3), 705-713 (1979)
 PUBMED 225041
REFERENCE 2 (bases 1 to 435)
 AUTHORS Sugisaki,H., Sugimoto,K., Takanami,M., Shiroki,K., Saito,I.,
 Shimojo,H., Sawada,Y., Uemizu,Y., Uesugi,S. and Fujinaga,K.
 TITLE Structure and gene organization in the transformed Hind III-G
 fragment of Ad12
 JOURNAL Cell 20 (3), 777-786 (1980)
 PUBMED 6251973
REFERENCE  3 (bases 1 to 435)
 AUTHORS Shinagawa,M. and Padmanabhan,R.
 TITLE Comparative sequence analysis of the inverted terminal repetitions
 from different adenoviruses
 JOURNAL Proc. Natl. Acad. Sci. U.S.A. 77 (7), 3831-3835 (1980)
 PUBMED 6253991
REFERENCE 4
 AUTHORS Kimura,T., Sawada,Y., Shinawawa,M., Shimizu,Y., Shiroki,K.,
 Shimojo,H., Sugisaki,H., Takanami,M., Uemizu,Y. and Fujinaga,K.
 TITLE Nucleotide sequence of the transforming early region E1b of
 adenovirus type 12 DNA: structure and gene organization, and
 comparison with those of adenovirus type 5 DNA
 JOURNAL Nucleic Acids Res. 9 (23), 6571-6589 (1981)
 PUBMED 6275367
 REMARK (sites)
REFERENCE 5 (bases 1 to 435)
 AUTHORS Kimura,T.
 TITLE Structure and sequence analysis of the transforming region E1B of
 human adenovirus type 12
 JOURNAL Sapporo Igaku Zasshi 52, 253-267 (1983)
REFERENCE 6 (bases 1 to 435)
 AUTHORS van Ormondt,H. and Galibert,F.
 TITLE Nucleotide sequences of adenovirus DNAs
  JOURNAL Curr. Top. Microbiol. Immunol. 110, 73-142 (1984)
 PUBMED 6383725
REFERENCE 7
 AUTHORS Juttermann,R., Weyer,U. and Doerfler,W.
 TITLE  Defect of adenovirus type 12 replication in hamster cells: absence
 of transcription of viral virus-associated and L1 RNAs
 JOURNAL J. Virol. 63 (8), 3535-3540 (1989)
 PUBMED 2746738
 REMARK (sites)
REFERENCE 8
 AUTHORS Zock,C., Iselt,A. and Doerfler,W.
 TITLE A unique mitigator sequence determines the species specificity of
 the major late promoter in adenovirus type 12 DNA
 JOURNAL J. Virol. 67 (2), 682-693 (1993)
 PUBMED 8419643
 REMARK (sites)
REFERENCE 9
 AUTHORS Sprengel,J., Schmitz,B., Heuss-Neitzel,D., Zock,C. and Doerfler,W.
 TITLE Nucleotide sequence of human adenovirus type 12 DNA: comparative
 functional analysis
 JOURNAL J. Virol. 68 (1), 379-389 (1994)
 PUBMED 8254750
REFERENCE 10 (bases 1 to 435)
 AUTHORS Sprengel,J.
 TITLE Direct Submission
 JOURNAL Submitted (21-JUN-1993) J. Sprengel, Institute of Genetics/Dept.
 Virology, Weyertal 121, 50931 Cologne 41, FRG
FEATURES Location/Qualifiers
 source 1..435
 /organism="Human adenovirus 12"
 /mol_type="genomic DNA"
  /db_xref="taxon:28282"
 CDS 1..435
 /note="crossref SWISS-PROT:HEX9_ADE12, P03284"
 /codon_start=1
  /product="hexon associated protein (Protein IX)"
 /protein_id="CAA51880.1"
 /db_xref="GI:313365"
 /db_xref="GOA:P03284"
 /db_xref="InterPro:IPR005641"
 /db_xref="UniProtKB/Swiss-Prot:P03284"
 /translation="MNGTTQNNAALFDGGVFSPYLTSRLPYWAGVRQNVVGSTVDGRP
 VAPANSSTLTYATIGPSPLDTAAAAAASAAASTARSMAADFSFYNHLASNAVTRTAVR
 EDILTVMLAKLETLTAQLEELSQKVEELADATTHTPAQPVTQ"
ORIGIN 
 1 atgaacggaa ctactcagaa caacgctgcg ctttttgatg gaggggtttt tagcccttat
 61 ttgacttcca ggttaccata ttgggccgga gtacgtcaga atgtggtagg atctacagtg
 121 gacggtcgac ctgtggcacc tgcaaattca tcaacattaa cctatgcaac tattggaccc
 181 tcgcctttgg ataccgccgc cgccgctgca gcttccgcgg ccgcttctac ggctcgcagt
 241 atggcagctg atttcagctt ctacaatcac ttggcttcga atgctgtgac acgcaccgca
 301 gttcgagagg acattctgac tgttatgctt gccaagcttg aaactctaac tgctcagctg
 361 gaagagctat cgcaaaaggt tgaggaatta gctgatgcta ctacccatac cccagcccaa
 421 cctgtaaccc aataa
//