LOCUS       X73487                  1749 bp    DNA     linear   VRL 14-NOV-2006
DEFINITION  Adenovirus type 12 DNA, complete genome.
ACCESSION   X73487 REGION: 11570..13318
VERSION     X73487.1  GI:313361
KEYWORDS    complete genome; core protein; DNA polymerase; DNA-binding protein;
            endoprotease; fiber protein; hexon protein; large T-antigen;
            maturation protein; minor core protein; penton protein;
            peripentonal hexon-associated protein; promoter; repeat region;
            small t-antigen; transcriptional activation.
SOURCE      Human adenovirus 12
  ORGANISM  Human adenovirus 12
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE   1
  AUTHORS   Kimura,T., Sawada,Y., Shinawawa,M., Shimizu,Y., Shiroki,K.,
            Shimojo,H., Sugisaki,H., Takanami,M., Uemizu,Y. and Fujinaga,K.
  TITLE     Nucleotide sequence of the transforming early region E1b of
            adenovirus type 12 DNA: structure and gene organization, and
            comparison with those of adenovirus type 5 DNA
  JOURNAL   Nucleic Acids Res. 9 (23), 6571-6589 (1981)
   PUBMED   6275367
  REMARK    (sites)
REFERENCE   2
  AUTHORS   Juttermann,R., Weyer,U. and Doerfler,W.
  TITLE     Defect of adenovirus type 12 replication in hamster cells: absence
            of transcription of viral virus-associated and L1 RNAs
  JOURNAL   J. Virol. 63 (8), 3535-3540 (1989)
   PUBMED   2746738
  REMARK    (sites)
REFERENCE   3
  AUTHORS   Zock,C., Iselt,A. and Doerfler,W.
  TITLE     A unique mitigator sequence determines the species specificity of
            the major late promoter in adenovirus type 12 DNA
  JOURNAL   J. Virol. 67 (2), 682-693 (1993)
   PUBMED   8419643
  REMARK    (sites)
REFERENCE   4
  AUTHORS   Sprengel,J., Schmitz,B., Heuss-Neitzel,D., Zock,C. and Doerfler,W.
  TITLE     Nucleotide sequence of human adenovirus type 12 DNA: comparative
            functional analysis
  JOURNAL   J. Virol. 68 (1), 379-389 (1994)
   PUBMED   8254750
REFERENCE   5  (bases 1 to 1749)
  AUTHORS   Sprengel,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-1993) J. Sprengel, Institute of Genetics/Dept.
            Virology, Weyertal 121, 50931 Cologne 41, FRG
FEATURES             Location/Qualifiers
     source          1..1749
                     /organism="Human adenovirus 12"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:28282"
     CDS             1..1749
                     /note="peripentonal hexon-associated protein (protein
                     IIIa); homologue to crossref SWISS-PROT:HEX3_ADE02,
                     HEX3_ADE05"
                     /codon_start=1
                     /product="hexon-associated protein"
                     /protein_id="CAA51886.1"
                     /db_xref="GI:313371"
                     /db_xref="GOA:P36712"
                     /db_xref="InterPro:IPR003479"
                     /db_xref="UniProtKB/Swiss-Prot:P36712"
                     /translation="MQRPAIIAERAPNLDPAVLAAMQSQPSGVTASDDWTAAMDRIMA
                     LTARSPDAFRQQPQANRFSAILEAVVPSRTNPTHEKVLTIVNALLDSKAIRKDEAGLI
                     YNALLERVARYNSTNVQANLDRMGTDVKEALAQRERFHRDGNLGSLVALNAFLSTQPA
                     NVPRGQEDYTNFISALRLMVTEVPQSEVYQSGPDYFFQTSRQGLQTVNLTQAFKNLQG
                     LWGVRAPVGDRSTLSSLLTPNSRLLLLLIAPFTNTNSLSRDSYLGHLVTLYREAIGQA
                     QVDEQTYQEITSVSRALGQEDTGSLEATLNFLLTNRRQQVPPQYTLNAEEERILRYVQ
                     QSVSLYLMREGATPSAALDMTARNMEPSFYASNRAFINRLMDYLHRAAAMNGEYFTNA
                     ILNPHWLPPPGFYTGEFDLPEGNDGFLWDDVTDSLFSPAVIGHHGKKEAGDEGPLLDS
                     RASSPFPSLTSLPASVNSGRTTRPRLTGESEYLNDPILFPVRDKNFPNNGIESLVDKM
                     SRWKTYAQERREWEERQPRPVRPPRQRWQRRKKGAHAGDEGSDDSADDSSVLDLGGSG
                     NPFAHLRPQGCIGSLY"
     misc_feature    complement(1212..1502)
                     /note="10K urf"
ORIGIN      
        1 atgcagcgac cggcgatcat cgcggagagg gctcctaacc tggatcccgc ggttttggcg
       61 gccatgcaaa gccagccttc tggcgttaca gcttcagatg actggacagc ggccatggat
      121 cgtattatgg ctttaacggc gcgcagtcct gatgcttttc gccagcagcc ccaagctaac
      181 cgcttttcgg ccattttgga agcagtagtg ccgtctcgta ctaaccctac tcacgagaaa
      241 gtgttaacca ttgtaaatgc tttgttggat agcaaagcca tccgcaaaga tgaggctggt
      301 ttaatataca acgctttgct tgagcgcgtg gcacgctata acagtaccaa tgtgcaggct
      361 aacttagacc ggatgggtac agatgtaaag gaggcgctgg ctcaacgaga gcgctttcat
      421 cgcgatggta atcttggttc gctagtagca ttaaacgctt ttttgagtac tcagccggct
      481 aatgttccgc gtggtcagga agattataca aacttcatca gcgccttgcg actaatggtt
      541 actgaagtgc ctcaaagtga agtgtatcag tctggacccg attacttttt tcaaacgtcc
      601 aggcagggtt tgcaaaccgt aaacttaact caggctttta aaaatttgca aggtttgtgg
      661 ggggttcgtg ctccagtagg cgatcgttca actttgtcca gtttactaac accaaactcg
      721 cgcctattac tgttgctaat tgcccccttt accaacacca acagtttaag tcgagattca
      781 tacctgggtc acttagttac tttgtaccgc gaagccattg gtcaagcgca ggtagacgaa
      841 caaacttatc aagaaataac cagtgttagt cgcgcactgg gccaggagga cactggcagt
      901 ttagaggcca cacttaactt tttactaact aaccgtcgcc agcaagtgcc tcctcagtac
      961 actttaaatg cggaagaaga acgcatattg cgctatgtac agcaatctgt aagtttgtat
     1021 cttatgcgtg agggtgccac ccccagtgcc gccttagaca tgacagcgcg caatatggag
     1081 ccgtccttct acgcttccaa tcgagctttc attaatcgct tgatggatta ccttcaccgc
     1141 gctgcggcca tgaacgggga atactttaca aatgcaattc taaatccgca ttggttgccc
     1201 cctcctggat tttacactgg tgaatttgat ttgccggaag gaaatgatgg ctttttgtgg
     1261 gatgatgtta cggacagtct gtttagtcct gcagttattg gacaccatgg taaaaaggaa
     1321 gcaggtgatg aaggtccctt gcttgactct cgggcgagtt ctccattccc cagtttaact
     1381 agtttacccg ccagtgttaa cagcggtcgt accaccagac cccgactaac aggtgaaagt
     1441 gaatacttaa atgaccccat cttgtttcca gtgcgcgaca aaaattttcc caacaatggc
     1501 atagaaagtt tggtagataa aatgtctcgc tggaaaacat atgcacaaga gcggcgagaa
     1561 tgggaggaaa gacagccaag accagttcgc cctcctaggc aacgttggca gcgacgcaaa
     1621 aaaggggcac atgcggggga tgaaggaagc gatgactcag ctgacgacag tagtgtatta
     1681 gatttaggag ggtcaggaaa cccatttgct catttgcgcc cacagggttg catagggtca
     1741 ttgtattaa
//