LOCUS X73487 1821 bp DNA linear VRL 14-NOV-2006
DEFINITION Adenovirus type 12 DNA, complete genome.
ACCESSION X73487 REGION: 8312..10132
VERSION X73487.1 GI:313361
KEYWORDS complete genome; core protein; DNA polymerase; DNA-binding protein;
 endoprotease; fiber protein; hexon protein; large T-antigen;
 maturation protein; minor core protein; penton protein;
 peripentonal hexon-associated protein; promoter; repeat region;
 small t-antigen; transcriptional activation.
SOURCE Human adenovirus 12
 ORGANISM Human adenovirus 12
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1
 AUTHORS Kimura,T., Sawada,Y., Shinawawa,M., Shimizu,Y., Shiroki,K.,
 Shimojo,H., Sugisaki,H., Takanami,M., Uemizu,Y. and Fujinaga,K.
 TITLE Nucleotide sequence of the transforming early region E1b of
 adenovirus type 12 DNA: structure and gene organization, and
 comparison with those of adenovirus type 5 DNA
 JOURNAL Nucleic Acids Res. 9 (23), 6571-6589 (1981)
 PUBMED 6275367
 REMARK (sites)
REFERENCE 2 (bases 1 to 1821)
 AUTHORS Shu,L.M., Hong,J.S., Wei,Y.F. and Engler,J.A.
 TITLE Nucleotide sequence of the genes encoded in early region 2b of
 human adenovirus type 12
 JOURNAL Gene 46 (2-3), 187-195 (1986)
 PUBMED 3803925
REFERENCE 3
 AUTHORS Juttermann,R., Weyer,U. and Doerfler,W.
 TITLE Defect of adenovirus type 12 replication in hamster cells: absence
 of transcription of viral virus-associated and L1 RNAs
 JOURNAL J. Virol. 63 (8), 3535-3540 (1989)
 PUBMED 2746738
 REMARK (sites)
REFERENCE 4
 AUTHORS Zock,C., Iselt,A. and Doerfler,W.
 TITLE A unique mitigator sequence determines the species specificity of
 the major late promoter in adenovirus type 12 DNA
 JOURNAL J. Virol. 67 (2), 682-693 (1993)
 PUBMED 8419643
 REMARK (sites)
REFERENCE 5
 AUTHORS Sprengel,J., Schmitz,B., Heuss-Neitzel,D., Zock,C. and Doerfler,W.
 TITLE Nucleotide sequence of human adenovirus type 12 DNA: comparative
 functional analysis
 JOURNAL J. Virol. 68 (1), 379-389 (1994)
 PUBMED 8254750
REFERENCE 6 (bases 1 to 1821)
 AUTHORS Sprengel,J.
 TITLE Direct Submission
 JOURNAL Submitted (21-JUN-1993) J. Sprengel, Institute of Genetics/Dept.
 Virology, Weyertal 121, 50931 Cologne 41, FRG
FEATURES Location/Qualifiers
 source 1..1821
 /organism="Human adenovirus 12"
 /mol_type="genomic DNA"
 /db_xref="taxon:28282"
 CDS complement(1..1821)
 /note="crossref SWISS-PROT:TERM_ADE12, P12541"
 /codon_start=1
 /product="DNA terminal protein"
 /protein_id="CAA51884.1"
  /db_xref="GI:313369"
 /db_xref="GOA:P12541"
 /db_xref="InterPro:IPR003391"
 /db_xref="UniProtKB/Swiss-Prot:P12541"
 /translation="MRATTTAAGITWMSRYIYEYHRLMLEDLAPGAAATLGWPLYREP
 PPHFLVGYQYLVRTCNDYVFDSRAYSRLRYTETVQPGTQTVNWSVMTNCSYTINAGAY
 HRFVDVDDFATTLTQIQQAVLAERVVADLALLQPLQGYGSTHMADRGNREVEVERLMQ
 DYYKDLGRCQSDVWGMADRLRIQQAGPKDVVLLKTIRGLKTAYFNYIISSIAQLPGTL
 EETKLSLPCDCDWLDAFLERFSDPVDMQTLSSLRGVPTQQIIKCIISAVSLPNAPRNA
 SFPILHETELRGGVFELRPRENGRAVTETMRRRRGEMIERFVDRLPVRRRRRRQPPPP
 VVEEEIMEVEEEEQEIVPGAFQQEVRETVAELIRLLEEELTVAARNSQFFNFAVDFYE
 AMERLEALGDINELTLRRWILYFFVSEHVATTLNYLFQRLRNYGVFARLVELNLAQVV
 MRARDSEGGVVYSRVWNEIGLNAFSQLMSRISNDLAATIERAGHGDLQEEEIDQLMAE
 IAYQDNSGDVQEILRQAAVNDTEIDSVELSFRFKTTGPVVFTQRRQIQDINRRVVAHA
 SQLRAQHLPLPERQADIPLPPLPAGPEPPLPPGARPRRRF"
 variation 606..607
 /citation=[2]
 /replace="cg"
 variation 1080
 /citation=[2]
 /replace="a"
ORIGIN 
 1 ttaaaatcgg cggcgcggac gagctcccgg aggaagcggc ggttcgggtc ctgcgggaag
 61 cgggggaagc ggtatgtcgg cctgacgctc tggcagggga aggtgttgag cccgaagttg
 121 actggcatgg gcgactaccc ggcgattgat atcttgaatc tgtcggcgtt gtgtaaacac
 181 taccggccct gttgttttga acctgaaaga aagttcaaca gaatcaatct cagtgtcatt
 241 tactgcagcc tgtcttaaaa tctcctgaac gtcgcctgag ttatcttggt aggcaatttc
 301 tgccattaat tgatcaattt cttcctcctg gaggtctcca tgtcccgcac gttcaatagt
 361 ggctgcaagg tcattagata tccgactcat aagctgtgaa aatgcgttta gtccaatttc
 421 gttccagact cggctgtata ctacccctcc ttcgctgtcc cgagcgcgca taaccacttg
 481 cgccaagttg agttccacga gccgtgcgaa cacgccgtag ttgcgcaagc gctgaaacag
 541 gtagtttaag gtggtggcaa cgtgttctga gacgaagaaa tacagaatcc accgacgaag
 601 cgtcagctcg ttgatgtcac ctaaggcttc aagacgttcc atggcttcgt aaaagtctac
 661 tgcaaaattg aaaaactggg agttgcgagc tgccaccgtc aattcttctt ccaacagacg
 721 aataagctcg gccaccgtct cgcgcacttc ttgctgaaat gcgcccggaa ctatttcttg
 781 ttcttcctct tctacctcca ttatttcttc ctcgaccaca ggtggtgggg gttgtcttct
 841 tcgacgccgg cgaacgggca gcctgtctac aaatctttca atcatttcgc cgcgacggcg
 901 gcgcatagtt tcggttactg ctcgaccgtt ttcacgtggt cgtaactcaa aaactccacc
 961 tctaagttct gtttcatgta aaatgggaaa tgaggcgttg cgaggggcgt taggtaggga
 1021 tacagcgctg attatgcatt ttattatttg ctgcgtagga actccgcgca aggagctaag
 1081 cgtctgcata tccaccgggt cggagaacct ttcaagaaag gcatctagcc agtcacagtc
 1141 acaaggtagg ctaagttttg tttcttctaa agtaccagga agctgagcaa tgctactaat
 1201 aatgtaattg aagtaagctg ttttaagccc acgaatggtt ttaagaagca ccacatcttt
 1261 gggtccggct tgttgaattc gcaggcggtc tgccattccc cacacgtcac tttgacatcg
 1321 tccaagatct ttgtagtagt cttgcattaa cctttccacc tctacctcgc ggtttccgcg
 1381 atcagccatg tgcgtgcttc cgtagccttg cagcggttgt aataaagcta aatctgccac
 1441 tacccgttcc gcaagcactg cctgttgaat ttgggtaagg gtggttgcaa agtcatccac
 1501 atctacaaag cggtgataag ctcctgcatt aatggtgtag ctgcagtttg tcattactga
 1561 ccaattaaca gtttgcgtgc ctggctgtac agtttctgtg tatcgcaagc gtgagtaagc
 1621 ccgagagtca aaaacatagt cattgcaggt gcgcactagg tattgatagc ccacaaggaa
 1681 atgaggagga ggttcgcgat acaacggcca gccaagcgta gccgcagcac ctggagcgag
 1741 atcttccaac atgaggcggt ggtattcata tatgtatctg gacatccatg tgatgccggc
 1801 agcggtagtt gttgctcgca t
//