LOCUS X73487 798 bp DNA linear VRL 14-NOV-2006
DEFINITION Adenovirus type 12 DNA, complete genome.
ACCESSION X73487 REGION: 16843..17640
VERSION X73487.1 GI:313361
KEYWORDS complete genome; core protein; DNA polymerase; DNA-binding protein;
 endoprotease; fiber protein; hexon protein; large T-antigen;
 maturation protein; minor core protein; penton protein;
 peripentonal hexon-associated protein; promoter; repeat region;
 small t-antigen; transcriptional activation.
SOURCE Human adenovirus 12
 ORGANISM Human adenovirus 12
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1
 AUTHORS Kimura,T., Sawada,Y., Shinawawa,M., Shimizu,Y., Shiroki,K.,
 Shimojo,H., Sugisaki,H., Takanami,M., Uemizu,Y. and Fujinaga,K.
 TITLE Nucleotide sequence of the transforming early region E1b of
 adenovirus type 12 DNA: structure and gene organization, and
 comparison with those of adenovirus type 5 DNA
 JOURNAL Nucleic Acids Res. 9 (23), 6571-6589 (1981)
 PUBMED 6275367
 REMARK (sites)
REFERENCE 2
 AUTHORS Juttermann,R., Weyer,U. and Doerfler,W.
 TITLE Defect of adenovirus type 12 replication in hamster cells: absence
 of transcription of viral virus-associated and L1 RNAs
 JOURNAL J. Virol. 63 (8), 3535-3540 (1989)
 PUBMED 2746738
 REMARK (sites)
REFERENCE 3
 AUTHORS Zock,C., Iselt,A. and Doerfler,W.
 TITLE A unique mitigator sequence determines the species specificity of
  the major late promoter in adenovirus type 12 DNA
 JOURNAL J. Virol. 67 (2), 682-693 (1993)
 PUBMED 8419643
 REMARK (sites)
REFERENCE 4
  AUTHORS Sprengel,J., Schmitz,B., Heuss-Neitzel,D., Zock,C. and Doerfler,W.
 TITLE Nucleotide sequence of human adenovirus type 12 DNA: comparative
 functional analysis
 JOURNAL J. Virol. 68 (1), 379-389 (1994)
 PUBMED 8254750
REFERENCE 5 (bases 1 to 798)
 AUTHORS Sprengel,J.
 TITLE Direct Submission
 JOURNAL Submitted (21-JUN-1993) J. Sprengel, Institute of Genetics/Dept.
 Virology, Weyertal 121, 50931 Cologne 41, FRG
FEATURES Location/Qualifiers
 source 1..798
 /organism="Human adenovirus 12"
 /mol_type="genomic DNA"
 /db_xref="taxon:28282"
 CDS 1..798
 /note="protein VI precursor; homologue to crossref
 SWISS-PROT:PIV6_ADE02, PIV6_ADE05"
  /codon_start=1
 /product="protein VI"
 /protein_id="CAA51890.1"
 /db_xref="GI:313375"
  /db_xref="GOA:P35988"
 /db_xref="InterPro:IPR004243"
 /db_xref="UniProtKB/Swiss-Prot:P35988"
 /translation="MEDINFSSLAPRHGTRPYMGTWNEIGTSQLNGGAFNWNSIWSGL
 KNFGSTIKTYGTKAWNSQTGQMLRDKLKDQNFQQKVVDGLASGINGVVDIANQAVQKK
 IANRLEPRPDEVMVEEKLPPLETVPGSVPTKGEKRPRPDAEETLVTHTTEPPSYEEAI
  KQGAALSPTTYPMTKPILPMATRVYGKNENVPMTLELPPLPEPTIADPVGSVPVASVP
 VASTVSRPAVRPVAVASLRNPRSSNWQSTLNSIVGLGVKSLKRRRCY"
ORIGIN 
 1 atggaagaca tcaatttttc gtcgctggcc ccgcgacacg gcacgcggcc gtacatgggc
 61 acctggaacg agatcggcac gagccagctg aacgggggcg ccttcaattg gaacagtatc
 121 tggagcggtc ttaaaaattt tggttccacg attaagacat atggcaccaa ggcgtggaac
 181 agccaaaccg gccagatgct aagggacaag ttaaaagacc aaaattttca acagaaagtt
 241 gtagatggtc tggcttcggg aattaatgga gttgtagaca tagccaatca ggctgtacag
 301 aaaaaaattg ccaaccgttt agagccgcgg cccgacgagg taatggtaga ggaaaagctg
 361 ccacctctag aaactgtgcc cggatccgtt ccaaccaaag gagaaaagcg gccacggccg
 421 gatgcagagg aaaccttagt aacgcacaca acagaaccgc cgtcctatga ggaagcaata
 481 aaacaaggag ccgctctgtc acctaccacc tatcccatga ccaagcctat tttacccatg
 541 gctactagag tgtatggaaa aaacgaaaat gtgcctatga cccttgagct gcctcctttg
 601 ccagaaccca ctatcgcgga tcccgtaggt tccgttcctg ttgcatctgt tccagttgca
 661 tcgacagtga gccgtccagc agtgcggcct gttgccgtgg ctagcttgcg aaacccacga
 721 tccagtaatt ggcaaagtac cctaaacagt attgtgggac tgggagtaaa gtctctcaaa
 781 cgccgacgct gctactaa
//