LOCUS       X73487                   702 bp    DNA     linear   VRL 14-NOV-2006
DEFINITION  Adenovirus type 12 DNA, complete genome.
ACCESSION   X73487 REGION: 25612..26313
VERSION     X73487.1  GI:313361
KEYWORDS    complete genome; core protein; DNA polymerase; DNA-binding protein;
            endoprotease; fiber protein; hexon protein; large T-antigen;
            maturation protein; minor core protein; penton protein;
            peripentonal hexon-associated protein; promoter; repeat region;
            small t-antigen; transcriptional activation.
SOURCE      Human adenovirus 12
  ORGANISM  Human adenovirus 12
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE   1
  AUTHORS   Kimura,T., Sawada,Y., Shinawawa,M., Shimizu,Y., Shiroki,K.,
            Shimojo,H., Sugisaki,H., Takanami,M., Uemizu,Y. and Fujinaga,K.
  TITLE     Nucleotide sequence of the transforming early region E1b of
            adenovirus type 12 DNA: structure and gene organization, and
            comparison with those of adenovirus type 5 DNA
  JOURNAL   Nucleic Acids Res. 9 (23), 6571-6589 (1981)
   PUBMED   6275367
  REMARK    (sites)
REFERENCE   2
  AUTHORS   Juttermann,R., Weyer,U. and Doerfler,W.
  TITLE     Defect of adenovirus type 12 replication in hamster cells: absence
            of transcription of viral virus-associated and L1 RNAs
  JOURNAL   J. Virol. 63 (8), 3535-3540 (1989)
   PUBMED   2746738
  REMARK    (sites)
REFERENCE   3
  AUTHORS   Zock,C., Iselt,A. and Doerfler,W.
  TITLE     A unique mitigator sequence determines the species specificity of
            the major late promoter in adenovirus type 12 DNA
  JOURNAL   J. Virol. 67 (2), 682-693 (1993)
   PUBMED   8419643
  REMARK    (sites)
REFERENCE   4
  AUTHORS   Sprengel,J., Schmitz,B., Heuss-Neitzel,D., Zock,C. and Doerfler,W.
  TITLE     Nucleotide sequence of human adenovirus type 12 DNA: comparative
            functional analysis
  JOURNAL   J. Virol. 68 (1), 379-389 (1994)
   PUBMED   8254750
REFERENCE   5  (bases 1 to 702)
  AUTHORS   Sprengel,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-JUN-1993) J. Sprengel, Institute of Genetics/Dept.
            Virology, Weyertal 121, 50931 Cologne 41, FRG
FEATURES             Location/Qualifiers
     source          1..702
                     /organism="Human adenovirus 12"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:28282"
     promoter        complement(<1..352)
                     /note="homologue to EII of Ad2 (EPD07153)"
                     /function="promoter region EII (-499 to +100)"
     promoter        <1..434
                     /note="homologue to EIII of Ad2 (EPD07154), Ad5
                     (EPD11199)"
                     /function="promoter region EIII (-499 to +100)"
     CDS             1..702
                     /note="hexon associated protein precursor (protein VIII);
                     homologue to crossref SWISS-PROT:HEX8_ADE02, HEX8_ADE03,
                     HEX8_ADE05, HEX8_ADE40, HEX8_ADE41, HEX8_ADEM1,
                     HEX8_ADEC1"
                     /codon_start=1
                     /product="hexon associated protein"
                     /protein_id="CAA51895.1"
                     /db_xref="GI:313380"
                     /db_xref="GOA:P36713"
                     /db_xref="InterPro:IPR000646"
                     /db_xref="UniProtKB/Swiss-Prot:P36713"
                     /translation="MSKDIPTPYMWSFQPQMGLAAGAAQDYSSKMNWLSAGPHMISRV
                     NGVRARRNQILLEQAALTATPRNQLNPPSWPAALIYQENPPPTTVLLPRDAQAEVHMT
                     NAGAQLAGGARHSFRYKGRTEPYPSPAIKRVLIRGKGIQLNDEVTSPLGVRPDGVFQL
                     GGSGRSSFTARQAYLTLQSSSSAPRSGGIGTLQFVEEFTPSVYFNPFSGSPGHYPDAF
                     IPNFDAVSESVDGYD"
     promoter        159..434
                     /note="homologue to EIII of Ad5 (EPD11199)"
                     /function="promoter region EIII (-499 to +100)"
     CDS             702..>702
                     /note="early E3 12.1 KD protein; alternative splicing;
                     homologue to crossref SWISS-PROT:E312_ADE02, E312_ADE03,
                     E312_ADE05"
                     /codon_start=1
                     /product="E3 12.1 KD protein"
                     /protein_id="CAA51896.1"
                     /db_xref="GI:313381"
                     /db_xref="InterPro:IPR007912"
                     /db_xref="UniProtKB/Swiss-Prot:P36706"
                     /translation="MSNGAADRARLRHLDHCRQPHCFARDICVFTYFELPEEHPQGPA
                     HGVRITVEKGIDTHLIKFFTKRPLLVEKDQGNTILTLYCICPVPGLHEDFCCHLCAEF
                     NHL"
ORIGIN      
        1 atgagtaaag atattcccac gccttacatg tggagctttc aaccccaaat gggactggcg
       61 gccggcgcgg ctcaagacta ttctagcaaa atgaattggt taagcgccgg accccacatg
      121 atttccaggg tgaatggggt acgagcccgg cgtaaccaaa tactgctaga acaagccgct
      181 ctcaccgcta caccacgtaa tcaacttaac cctccctctt ggccagctgc cctgatatat
      241 caggaaaatc cccctcctac cactgtactt ttgcctcgcg acgcccaggc cgaagtccat
      301 atgactaacg ctggggcaca gcttgcgggc ggtgcacgtc acagtttcag gtataaaggt
      361 cgcactgagc cctatccgtc tccagctata aaaagagtac tcatcagagg gaaaggtatt
      421 cagctgaacg acgaagtcac atcgccattg ggagtcagac ccgacggagt gtttcagctc
      481 ggagggtccg gacgttcctc ctttaccgct cgtcaagcct acctgacact acagagctca
      541 tcctcagctc cgagatctgg tggtattgga actctccaat ttgtggagga atttactcca
      601 tctgtttact tcaatccttt ttcgggctcg cctggacact atcctgacgc cttcataccc
      661 aactttgacg cagtgagtga atctgtggat ggctatgatt aa
//