LOCUS X73487 219 bp DNA linear VRL 14-NOV-2006
DEFINITION Adenovirus type 12 DNA, complete genome.
ACCESSION X73487 REGION: 16568..16786
VERSION X73487.1 GI:313361
KEYWORDS complete genome; core protein; DNA polymerase; DNA-binding protein;
 endoprotease; fiber protein; hexon protein; large T-antigen;
 maturation protein; minor core protein; penton protein;
 peripentonal hexon-associated protein; promoter; repeat region;
 small t-antigen; transcriptional activation.
SOURCE Human adenovirus 12
 ORGANISM Human adenovirus 12
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1
 AUTHORS Kimura,T., Sawada,Y., Shinawawa,M., Shimizu,Y., Shiroki,K.,
 Shimojo,H., Sugisaki,H., Takanami,M., Uemizu,Y. and Fujinaga,K.
 TITLE Nucleotide sequence of the transforming early region E1b of
 adenovirus type 12 DNA: structure and gene organization, and
 comparison with those of adenovirus type 5 DNA
 JOURNAL Nucleic Acids Res. 9 (23), 6571-6589 (1981)
 PUBMED 6275367
 REMARK (sites)
REFERENCE 2
 AUTHORS Juttermann,R., Weyer,U. and Doerfler,W.
 TITLE Defect of adenovirus type 12 replication in hamster cells: absence
 of transcription of viral virus-associated and L1 RNAs
 JOURNAL J. Virol. 63 (8), 3535-3540 (1989)
 PUBMED 2746738
 REMARK (sites)
REFERENCE 3
 AUTHORS Zock,C., Iselt,A. and Doerfler,W.
 TITLE A unique mitigator sequence determines the species specificity of
  the major late promoter in adenovirus type 12 DNA
 JOURNAL J. Virol. 67 (2), 682-693 (1993)
 PUBMED 8419643
 REMARK (sites)
REFERENCE 4
 AUTHORS Sprengel,J., Schmitz,B., Heuss-Neitzel,D., Zock,C. and Doerfler,W.
 TITLE Nucleotide sequence of human adenovirus type 12 DNA: comparative
 functional analysis
 JOURNAL J. Virol. 68 (1), 379-389 (1994)
 PUBMED 8254750
REFERENCE 5 (bases 1 to 219)
 AUTHORS Sprengel,J.
 TITLE Direct Submission
 JOURNAL Submitted (21-JUN-1993) J. Sprengel, Institute of Genetics/Dept.
 Virology, Weyertal 121, 50931 Cologne 41, FRG
FEATURES Location/Qualifiers
 source 1..219
 /organism="Human adenovirus 12"
 /mol_type="genomic DNA"
 /db_xref="taxon:28282"
 CDS 1..219
 /note="11KD core protein precursor (Protein X); homologue
 to crossref SWISS-PROT:11KD_ADE02"
 /codon_start=1
 /product="11KD core protein"
 /protein_id="CAA51889.1"
 /db_xref="GI:313374"
 /db_xref="GOA:P35986"
 /db_xref="UniProtKB/Swiss-Prot:P35986"
 /translation="MALTCRMRIPIPGYRGRPRRRKGLTGNGRFRRRSMRRRMKGGVL
  PFLIPLIAAAIGAVPGIASVALQASRKN"
ORIGIN 
 1 atggctctta cttgccgaat gcgcataccc attccaggat acagaggacg accccgccgg
 61 aggaaagggc tgaccgggaa cggtcgattt cggcggcgta gtatgcgcag acgcatgaag
 121 ggtggggtgc tgcccttcct aattccactt attgctgcgg ccattggagc cgttcccgga
 181 attgcctcag tagccttgca ggcttctcga aaaaattaa
//