LOCUS X73487 1044 bp DNA linear VRL 14-NOV-2006
DEFINITION Adenovirus type 12 DNA, complete genome.
ACCESSION X73487 REGION: 15500..16543
VERSION X73487.1 GI:313361
KEYWORDS complete genome; core protein; DNA polymerase; DNA-binding protein;
 endoprotease; fiber protein; hexon protein; large T-antigen;
 maturation protein; minor core protein; penton protein;
 peripentonal hexon-associated protein; promoter; repeat region;
 small t-antigen; transcriptional activation.
SOURCE Human adenovirus 12
 ORGANISM Human adenovirus 12
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1
 AUTHORS Kimura,T., Sawada,Y., Shinawawa,M., Shimizu,Y., Shiroki,K.,
 Shimojo,H., Sugisaki,H., Takanami,M., Uemizu,Y. and Fujinaga,K.
 TITLE Nucleotide sequence of the transforming early region E1b of
 adenovirus type 12 DNA: structure and gene organization, and
 comparison with those of adenovirus type 5 DNA
 JOURNAL Nucleic Acids Res. 9 (23), 6571-6589 (1981)
 PUBMED 6275367
 REMARK (sites)
REFERENCE 2
 AUTHORS Juttermann,R., Weyer,U. and Doerfler,W.
 TITLE Defect of adenovirus type 12 replication in hamster cells: absence
 of transcription of viral virus-associated and L1 RNAs
 JOURNAL J. Virol. 63 (8), 3535-3540 (1989)
 PUBMED 2746738
 REMARK (sites)
REFERENCE 3
 AUTHORS Zock,C., Iselt,A. and Doerfler,W.
 TITLE A unique mitigator sequence determines the species specificity of
  the major late promoter in adenovirus type 12 DNA
 JOURNAL J. Virol. 67 (2), 682-693 (1993)
 PUBMED 8419643
 REMARK (sites)
REFERENCE 4
 AUTHORS Sprengel,J., Schmitz,B., Heuss-Neitzel,D., Zock,C. and Doerfler,W.
 TITLE Nucleotide sequence of human adenovirus type 12 DNA: comparative
 functional analysis
 JOURNAL J. Virol. 68 (1), 379-389 (1994)
 PUBMED 8254750
REFERENCE 5 (bases 1 to 1044)
 AUTHORS Sprengel,J.
 TITLE Direct Submission
 JOURNAL Submitted (21-JUN-1993) J. Sprengel, Institute of Genetics/Dept.
 Virology, Weyertal 121, 50931 Cologne 41, FRG
FEATURES Location/Qualifiers
 source 1..1044
 /organism="Human adenovirus 12"
 /mol_type="genomic DNA"
 /db_xref="taxon:28282"
 misc_feature complement(<1..326)
 /note="12.4K urf"
 CDS 1..1044
 /note="minor core protein (protein V); homologue to
 crossref SWISS-PROT:VCOM_ADE02, VCOM_ADE05"
 /codon_start=1
 /product="minor core protein"
 /protein_id="CAA51888.1"
 /db_xref="GI:313373"
 /db_xref="GOA:P36717"
 /db_xref="InterPro:IPR005608"
 /db_xref="UniProtKB/Swiss-Prot:P36717"
 /translation="MPSMTKRKFKEELLQALAPEIYGPSDNLTKRDIKHVKKREKKEE
 EVAAASADGVEFVRSFAPRRRVQWKGRQVKRILRPGTTVVFSPGERTIMRPLKREYDE
 VYADDDILEQAAQQTGEFAYGKKGRYGDKIAIPLDEGNPTPSLKAVTLQQVLPVLGPS
 EEKRGIKREAMDELQPTMQLMVPKRQKLEDVLEHMKVDPSVQPDVKVRPIKKVAPGLG
 VQTVDIQIPVQTALGETMEIQTSPIKTTVNASVQTDPWYPPVLSTKKKRHYRQTSSLL
 PDYVLHPSIVPTPGYRGTTFQRRATAPSRRRGPSRRRRRRKATLAPAAVRRVVQRGRT
 LILPSVRYHPSIL"
ORIGIN 
 1 atgcccagca tgaccaaacg caagttcaaa gaagagctgc tgcaggcctt agcgcctgaa
 61 atatatggcc catcggataa ccttaccaag cgcgatatca agcatgttaa aaaacgggaa
 121 aaaaaagagg aagaagtcgc cgcggcgtca gcagacggcg tcgagtttgt gcgctcattt
 181 gcgcccagac gtagggtaca gtggaaggga cggcaagtaa aacgcatttt gcgaccgggc
 241 accacagtgg ttttttctcc cggagagcga acgattatgc gtcccctaaa gcgcgagtac
 301 gacgaagtgt acgcagacga tgacattttg gagcaagcgg cacaacagac tggggaattt
 361 gcatatggaa aaaaagggcg ttacggagac aaaattgcta ttcctttgga cgagggaaat
 421 ccaacaccca gtttaaaggc tgtcactttg caacaagtgt tgcccgtcct tgggccttcg
 481 gaagaaaagc gtggaattaa aagggaagcc atggatgaat tgcagcctac aatgcaactg
 541 atggtgccta agcggcaaaa gttagaggac gtactagagc acatgaaggt ggatcctagc
 601 gtacagccag atgtaaaagt acgtccgata aaaaaggtag ctccaggatt gggagttcaa
 661 acagtggaca ttcaaattcc tgtgcaaact gcattgggtg aaactatgga aatccaaact
 721 tcgccaataa aaacaacggt gaacgcaagc gtgcaaacag acccttggta cccgccagtg
 781 ctttcaacaa aaaaaaagcg tcactacaga caaacaagtt cgcttttgcc agactacgtt
 841 ttacatcctt ccattgtgcc cacgcctggg taccgtggga caacttttca gcgccgagcc
 901 acagccccta gccgtagacg aggtccatca cgccgtagac gtcgacgcaa agccacttta
 961 gccccagcgg cagtacgtcg cgttgtacaa agggggcgca cactaatact tccatccgtg
 1021 cgttaccacc ctagcattct ctaa
//