LOCUS AY163756 789 bp DNA linear VRL 31-MAR-2005
DEFINITION Human adenovirus type 11 strain Ad11p Slobitski, complete genome.
ACCESSION AY163756 REGION: join(568..1147,1232..1440)
VERSION AY163756.1 GI:24711762
KEYWORDS .
SOURCE Human adenovirus 11
 ORGANISM Human adenovirus 11
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 789)
 AUTHORS Stone,D., Furthmann,A., Sandig,V. and Lieber,A.
 TITLE The complete nucleotide sequence, genome organization, and origin
 of human adenovirus type 11
 JOURNAL Virology 309 (1), 152-165 (2003)
 PUBMED 12726735
REFERENCE 2 (bases 1 to 789)
 AUTHORS Stone,D., Ni,S., Li,Z.Y., Gaggar,A., DiPaolo,N., Feng,Q., Sandig,V.
 and Lieber,A.
 TITLE Development and assessment of human adenovirus type 11 as a gene
 transfer vector
 JOURNAL J. Virol. 79 (8), 5090-5104 (2005)
 PUBMED 15795294
REFERENCE 3 (bases 1 to 789)
 AUTHORS Stone,D., Furthmann,A., Sandig,V. and Lieber,A.
 TITLE Direct Submission
 JOURNAL Submitted (16-OCT-2002) Division of Medical Genetics, University of
 Washington, Health Sciences Building, 1705 NE Pacific Street,
 Seattle, WA 98195, USA
FEATURES Location/Qualifiers
 source 1..789
 /organism="Human adenovirus 11"
 /mol_type="genomic DNA"
 /strain="Ad11p Slobitski"
 /db_xref="taxon:10541"
 CDS 1..789
 /codon_start=1
 /product="E1A 29.1 kDa protein"
 /protein_id="AAN62486.1"
 /db_xref="GI:24711765"
 /translation="MRDLRFLPQEIISAETGNEILELVVHALMGDDPEPPVQLFEPPT
 LQELYDLEVEGSEDSNEEAVNGFFTDSMLLAANEGLELDPPLDTFDTPGVIVESGTGV
 RKLPDLSSVDCDLHCYEDGFPPSDEEDHEKEQSMQTAAGEGVKAANVGFQLDCPELPG
 HGCKSCEFHRKNTGVKELLCSLCYMRTHCHFIYSPVSDADESPSPDSTTSPPEIQAPV
 PVDVRKPIPVKLKPGKRPAVEKLEDLLQGGDGPLDLSTRKRPRQ"
 CDS join(1..487,581..789)
 /codon_start=1
 /product="E1A 25.7 kDa protein"
 /protein_id="AAN62485.1"
 /db_xref="GI:24711764"
 /translation="MRDLRFLPQEIISAETGNEILELVVHALMGDDPEPPVQLFEPPT
 LQELYDLEVEGSEDSNEEAVNGFFTDSMLLAANEGLELDPPLDTFDTPGVIVESGTGV
 RKLPDLSSVDCDLHCYEDGFPPSDEEDHEKEQSMQTAAGEGVKAANVGFQLDCPELPG
 HGCPVSDADESPSPDSTTSPPEIQAPVPVDVRKPIPVKLKPGKRPAVEKLEDLLQGGD
 GPLDLSTRKRPRQ"
 CDS join(1..72,581..685)
 /codon_start=1
 /product="E1A 6.5 kDa protein"
 /protein_id="AAN62484.1"
 /db_xref="GI:24711763"
 /translation="MRDLRFLPQEIISAETGNEILELVVLCLMLMNHHLLILLPHLLR
 FKHLFLWTCASPFL"
ORIGIN 
 1 atgagagatt tgcgatttct gcctcaggaa ataatctctg ctgagactgg aaatgaaata
 61 ttggagcttg tggtgcacgc cctgatggga gacgatccgg agccacctgt gcagcttttt
 121 gagcctccta cgcttcagga actgtatgat ttagaggtag agggatcgga ggattctaat
 181 gaggaagctg taaatggctt ttttaccgat tctatgcttt tagctgctaa tgaagggtta
 241 gaattagatc cgcctttgga cacttttgat actccagggg taattgtgga aagcggtaca
 301 ggtgtaagaa aattacctga tttgagttcc gtggactgtg atttgcactg ctatgaagac
 361 gggtttcctc cgagtgatga ggaggaccat gaaaaggagc agtccatgca gactgcagcg
 421 ggtgagggag tgaaggctgc caatgttggt tttcagttgg attgcccgga gcttcctgga
 481 catggctgta agtcttgtga atttcacagg aaaaatactg gagtaaagga actgttatgt
 541 tcgctttgtt atatgagaac gcactgccac tttatttaca gtcctgtgtc tgatgctgat
 601 gaatcaccat ctcctgattc tactacctca cctcctgaga ttcaagcacc tgttcctgtg
 661 gacgtgcgca agcccattcc tgtgaagctt aagcctggga aacgtccagc agtggaaaaa
 721 cttgaggact tgttacaggg tggggacgga cctttggact tgagtacacg gaaacgtcca
 781 agacaataa
//