LOCUS AY163756 318 bp DNA linear VRL 31-MAR-2005
DEFINITION Human adenovirus type 11 strain Ad11p Slobitski, complete genome.
ACCESSION AY163756 REGION: 27184..27501
VERSION AY163756.1 GI:24711762
KEYWORDS .
SOURCE Human adenovirus 11
 ORGANISM Human adenovirus 11
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 318)
 AUTHORS Stone,D., Furthmann,A., Sandig,V. and Lieber,A.
 TITLE The complete nucleotide sequence, genome organization, and origin
 of human adenovirus type 11
 JOURNAL Virology 309 (1), 152-165 (2003)
 PUBMED 12726735
REFERENCE 2 (bases 1 to 318)
 AUTHORS Stone,D., Ni,S., Li,Z.Y., Gaggar,A., DiPaolo,N., Feng,Q., Sandig,V.
 and Lieber,A.
 TITLE Development and assessment of human adenovirus type 11 as a gene
 transfer vector
 JOURNAL J. Virol. 79 (8), 5090-5104 (2005)
 PUBMED 15795294
REFERENCE 3 (bases 1 to 318)
 AUTHORS Stone,D., Furthmann,A., Sandig,V. and Lieber,A.
 TITLE Direct Submission
 JOURNAL Submitted (16-OCT-2002) Division of Medical Genetics, University of
 Washington, Health Sciences Building, 1705 NE Pacific Street,
 Seattle, WA 98195, USA
FEATURES Location/Qualifiers
 source 1..318
  /organism="Human adenovirus 11"
 /mol_type="genomic DNA"
 /strain="Ad11p Slobitski"
 /db_xref="taxon:10541"
 CDS <1
 /codon_start=1
 /product="L4 pVIII 25.2 kDa protein"
 /protein_id="AAN62520.1"
  /db_xref="GI:24711799"
 /translation="MSKEIPTPYMWSYQPQMGLAAGASQDYSTRMNWLSAGPSMISRV
 NDIRAYRNQILLEQSALTTTPRQHLNPRNWPAALVYQESPAPTTVLLPRDAQAEVQMT
 NAGAQLAGGSTLCRHRPRHNIKRLMIRGRGIQLNDESVSSPLGLRPDGIFQIAGCGRS
 SFTPRQAVLTLESSSSQPRSGGIGTVQFVEEFTPSVYFNPFSGSPGHYPDEFIPNFDA
 ISESVDGYD"
 CDS 1..318
 /codon_start=1
 /product="E3 11.7 kDa protein"
  /protein_id="AAN62493.1"
 /db_xref="GI:24711772"
 /translation="MSGDAAELSRLRHLDHCRRFRCFARELIEFIYFELPKDHPQGPA
  HGVRISIEGKIDSRLQRIFSQRPVLIERDQGNTTVSIYCICNHPGLHESLCCLMCTEF
 NKN"
 CDS 272..>318
 /codon_start=1
 /product="E3 14.6 kDa protein"
 /protein_id="AAN62494.1"
 /db_xref="GI:24711773"
 /translation="MKAFAVLCVLSLIKTELRLSYGLPLLQPGFYNQKNETFPVVQDS
 VNFTFPTHKLEAQRLHRFSRSIFPTNTTFKTGGELQGLPTENPWVEAGLVVLGILAGG
 LVIILCYLYTPCFTFLVVLWYWFKKWGPY"
 polyA_signal 307..312
 /note="L4"
ORIGIN 
 1 atgtctggtg acgcggctga gctatctcgg ctgcgacatc tagaccactg ccgccgcttt
 61 cgctgctttg cccgggaact cattgagttc atctacttcg aactccccaa ggatcaccct
 121 caaggtccgg cccacggagt gcggatttct atcgaaggca aaatagactc tcgcctgcaa
 181 cgaattttct cccagcggcc cgtgctgatc gagcgagacc agggaaacac cacggtttcc
 241 atctactgca tttgtaatca ccccggattg catgaaagcc tttgctgtct tatgtgtact
 301 gagtttaata aaaactga
//