LOCUS AY163756 144 bp DNA linear VRL 31-MAR-2005
DEFINITION Human adenovirus type 11 strain Ad11p Slobitski, complete genome.
ACCESSION AY163756 REGION: 17171..17314
VERSION AY163756.1 GI:24711762
KEYWORDS .
SOURCE Human adenovirus 11
ORGANISM Human adenovirus 11
Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 144)
AUTHORS Stone,D., Furthmann,A., Sandig,V. and Lieber,A.
TITLE The complete nucleotide sequence, genome organization, and origin
of human adenovirus type 11
JOURNAL Virology 309 (1), 152-165 (2003)
PUBMED 12726735
REFERENCE 2 (bases 1 to 144)
AUTHORS Stone,D., Ni,S., Li,Z.Y., Gaggar,A., DiPaolo,N., Feng,Q., Sandig,V.
and Lieber,A.
TITLE Development and assessment of human adenovirus type 11 as a gene
transfer vector
JOURNAL J. Virol. 79 (8), 5090-5104 (2005)
PUBMED 15795294
REFERENCE 3 (bases 1 to 144)
AUTHORS Stone,D., Furthmann,A., Sandig,V. and Lieber,A.
TITLE Direct Submission
JOURNAL Submitted (16-OCT-2002) Division of Medical Genetics, University of
Washington, Health Sciences Building, 1705 NE Pacific Street,
Seattle, WA 98195, USA
FEATURES Location/Qualifiers
source 1..144
/organism="Human adenovirus 11"
/mol_type="genomic DNA"
/strain="Ad11p Slobitski"
/db_xref="taxon:10541"
CDS 1..144
/codon_start=1
/product="L2 pX 5.4 kDa protein"
/protein_id="AAN62513.1"
/db_xref="GI:24711792"
/translation="MRRYRRRRAIRKQLRGGFLPALIPIIAAAIGAIPGIASVAVQAS
QRH"
ORIGIN
1 atgcgacgct acaggcgacg gcgtgctatc cgcaagcaat tgcggggtgg ttttttacca
61 gccttaattc caattatcgc tgctgcaatt ggcgcgatac caggcatagc ttccgtggcg
121 gttcaggcct cgcaacgaca ttga
//