LOCUS       AY163756                 144 bp    DNA     linear   VRL 31-MAR-2005
DEFINITION  Human adenovirus type 11 strain Ad11p Slobitski, complete genome.
ACCESSION   AY163756 REGION: 17171..17314
VERSION     AY163756.1  GI:24711762
KEYWORDS    .
SOURCE      Human adenovirus 11
  ORGANISM  Human adenovirus 11
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE   1  (bases 1 to 144)
  AUTHORS   Stone,D., Furthmann,A., Sandig,V. and Lieber,A.
  TITLE     The complete nucleotide sequence, genome organization, and origin
            of human adenovirus type 11
  JOURNAL   Virology 309 (1), 152-165 (2003)
   PUBMED   12726735
REFERENCE   2  (bases 1 to 144)
  AUTHORS   Stone,D., Ni,S., Li,Z.Y., Gaggar,A., DiPaolo,N., Feng,Q., Sandig,V.
            and Lieber,A.
  TITLE     Development and assessment of human adenovirus type 11 as a gene
            transfer vector
  JOURNAL   J. Virol. 79 (8), 5090-5104 (2005)
   PUBMED   15795294
REFERENCE   3  (bases 1 to 144)
  AUTHORS   Stone,D., Furthmann,A., Sandig,V. and Lieber,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-OCT-2002) Division of Medical Genetics, University of
            Washington, Health Sciences Building, 1705 NE Pacific Street,
            Seattle, WA 98195, USA
FEATURES             Location/Qualifiers
     source          1..144
                     /organism="Human adenovirus 11"
                     /mol_type="genomic DNA"
                     /strain="Ad11p Slobitski"
                     /db_xref="taxon:10541"
     CDS             1..144
                     /codon_start=1
                     /product="L2 pX 5.4 kDa protein"
                     /protein_id="AAN62513.1"
                     /db_xref="GI:24711792"
                     /translation="MRRYRRRRAIRKQLRGGFLPALIPIIAAAIGAIPGIASVAVQAS
                     QRH"
ORIGIN      
        1 atgcgacgct acaggcgacg gcgtgctatc cgcaagcaat tgcggggtgg ttttttacca
       61 gccttaattc caattatcgc tgctgcaatt ggcgcgatac caggcatagc ttccgtggcg
      121 gttcaggcct cgcaacgaca ttga
//