LOCUS AY601636 417 bp DNA linear VRL 12-APR-2006
DEFINITION Human adenovirus type 16 strain ch. 79, complete genome.
ACCESSION AY601636 REGION: 3476..3892
VERSION AY601636.1 GI:57116031
KEYWORDS .
SOURCE Human adenovirus 16
 ORGANISM Human adenovirus 16
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 417)
 AUTHORS Lin,B., Wang,Z., Vora,G.J., Thornton,J.A., Schnur,J.M., Thach,D.C.,
 Blaney,K.M., Ligler,A.G., Malanoski,A.P., Santiago,J., Walter,E.A.,
 Agan,B.K., Metzgar,D., Seto,D., Daum,L.T., Kruzelock,R.,
 Rowley,R.K., Hanson,E.H., Tibbetts,C. and Stenger,D.A.
 TITLE Broad-spectrum respiratory tract pathogen identification using
 resequencing DNA microarrays
 JOURNAL Genome Res. 16 (4), 527-535 (2006)
 PUBMED 16481660
REFERENCE 2 (bases 1 to 417)
 AUTHORS Tibbetts,C., Purkayastha,A., Su,J., Carlisle,S., Ospina,R.,
 Reynolds,T., Rowley,R., Hanson,E. and Seto,D.
 CONSRTM Epidemic Outbreak Surveillance (EOS)
 TITLE The complete nucleotide sequence and genome organization of Human
 Adenovirus Serotype 16
 JOURNAL Unpublished
REFERENCE 3 (bases 1 to 417)
 AUTHORS Tibbetts,C., Purkayastha,A., Su,J., Carlisle,S., Ospina,R.,
 Reynolds,T., Rowley,R., Hanson,E. and Seto,D.
 CONSRTM Epidemic Outbreak Surveillance (EOS)
 TITLE Direct Submission
 JOURNAL Submitted (16-APR-2004) Modernization Directorate (SGR), USAF
 Surgeon General Office HQ, 5201 Leesburg Pike, Suite 1401, Falls
 Church, VA 22041, USA
FEATURES Location/Qualifiers
 source  1..417
 /organism="Human adenovirus 16"
 /mol_type="genomic DNA"
 /strain="ch. 79"
 /serotype="16"
 /db_xref="taxon:31544"
 gene <1..>417
 /gene="IX"
 CDS 1..417
 /gene="IX"
 /codon_start=1
 /product="hexon-associated protein IX"
 /protein_id="AAW33430.1"
 /db_xref="GI:57116037"
 /translation="MSGSASFEGGVFSPYLTGRLPPWAGVRQNVMGSTVDGRPVQPAN
 SSTLTYATLSSSPLDAAAAAAATAAANTILGMGYYGSIVANSSSSNNPSTLAEDKLLV
 LLAQLEALTQRLGELSKQVAQLREQTQSAVATAKSK"
ORIGIN 
 1 atgagtggaa gcgcttcttt tgagggggga gtatttagcc cttatctgac gggcaggctc
 61 ccaccatggg caggagttcg tcagaatgtc atgggatcca ctgtggatgg gagacccgtc
 121 cagcccgcca attcctcaac gctgacctat gccactttga gttcgtcacc attggatgca
 181 gctgcagccg ccgccgctac tgctgccgcc aacaccatcc ttggaatggg ctattacgga
 241 agcatcgttg ccaattccag ttcctctaat aacccttcaa ccctggctga ggacaagcta
 301 cttgttctct tggctcagct cgaggcctta acccaacgct taggcgaact gtctaagcag
 361 gtggcccagt tgcgtgagca aactcagtct gctgttgcca cagcaaagtc taaataa
//