LOCUS AY601636 786 bp DNA linear VRL 12-APR-2006
DEFINITION Human adenovirus type 16 strain ch. 79, complete genome.
ACCESSION AY601636 REGION: join(574..1153,1247..1452)
VERSION AY601636.1 GI:57116031
KEYWORDS .
SOURCE Human adenovirus 16
 ORGANISM Human adenovirus 16
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 786)
 AUTHORS Lin,B., Wang,Z., Vora,G.J., Thornton,J.A., Schnur,J.M., Thach,D.C.,
 Blaney,K.M., Ligler,A.G., Malanoski,A.P., Santiago,J., Walter,E.A.,
 Agan,B.K., Metzgar,D., Seto,D., Daum,L.T., Kruzelock,R.,
 Rowley,R.K., Hanson,E.H., Tibbetts,C. and Stenger,D.A.
 TITLE Broad-spectrum respiratory tract pathogen identification using
  resequencing DNA microarrays
 JOURNAL Genome Res. 16 (4), 527-535 (2006)
 PUBMED 16481660
REFERENCE 2 (bases 1 to 786)
 AUTHORS Tibbetts,C., Purkayastha,A., Su,J., Carlisle,S., Ospina,R.,
 Reynolds,T., Rowley,R., Hanson,E. and Seto,D.
 CONSRTM Epidemic Outbreak Surveillance (EOS)
 TITLE The complete nucleotide sequence and genome organization of Human
 Adenovirus Serotype 16
 JOURNAL Unpublished
REFERENCE 3 (bases 1 to 786)
 AUTHORS Tibbetts,C., Purkayastha,A., Su,J., Carlisle,S., Ospina,R.,
 Reynolds,T., Rowley,R., Hanson,E. and Seto,D.
 CONSRTM Epidemic Outbreak Surveillance (EOS)
 TITLE Direct Submission
 JOURNAL Submitted (16-APR-2004) Modernization Directorate (SGR), USAF
 Surgeon General Office HQ, 5201 Leesburg Pike, Suite 1401, Falls
 Church, VA 22041, USA
FEATURES Location/Qualifiers
  source 1..786
 /organism="Human adenovirus 16"
 /mol_type="genomic DNA"
 /strain="ch. 79"
 /serotype="16"
 /db_xref="taxon:31544"
 gene <1..>786
 /gene="E1A"
 CDS 1..786
 /gene="E1A"
 /codon_start=1
  /product="28 kDa protein"
 /protein_id="AAW33427.1"
 /db_xref="GI:57116034"
 /translation="MRHLRFLPQEIISSETGIEILEFVVNTLMGDDPEPPVQPFDPPT
 LHDLYDLEVDGPDDPNEEAVNGFFTDSMLLAADEGLDINPPPETLDTPGVVVESGRGG
 KKLPDLGAAEMDLRCYEEGFPPSDDEDGETEQSIHTAVNEGVKAASDVFKLDCPELPG
 HGCKSCEFHRNNTGMKELLCSLCYMRMHCHFIYSPVSDDESPSPDSTTSPPEIQAPVP
 ANVCKPIPVKPKSGKRPAVDKLEDLLEGGDGPLDLSTRKLPRQ"
 CDS join(1..487,581..786)
 /gene="E1A"
 /codon_start=1
 /product="25.7 kDa protein"
 /protein_id="AAW33426.1"
 /db_xref="GI:57116033"
 /translation="MRHLRFLPQEIISSETGIEILEFVVNTLMGDDPEPPVQPFDPPT
 LHDLYDLEVDGPDDPNEEAVNGFFTDSMLLAADEGLDINPPPETLDTPGVVVESGRGG
 KKLPDLGAAEMDLRCYEEGFPPSDDEDGETEQSIHTAVNEGVKAASDVFKLDCPELPG
 HGCPVSDDESPSPDSTTSPPEIQAPVPANVCKPIPVKPKSGKRPAVDKLEDLLEGGDG
  PLDLSTRKLPRQ"
 CDS join(1..72,581..682)
 /gene="E1A"
 /codon_start=1
 /product="6.3 kDa protein"
 /protein_id="AAW33425.1"
 /db_xref="GI:57116032"
 /translation="MRHLRFLPQEIISSETGIEILEFVVLCLMMSHLLLIQLPHLLKF
 RRPYLQTYASPFL"
ORIGIN 
 1 atgagacacc tgcgattcct gccacaggag attatctcca gcgagaccgg gatcgaaata
 61 ctggagtttg tggtaaatac cctgatggga gatgacccgg aaccgccagt gcagcctttc
 121 gatccaccta cgctgcacga tctgtatgat ttagaggtag acgggcctga tgatcccaat
 181 gaggaagctg taaatgggtt ttttactgat tctatgctgc tagctgccga tgaaggattg
 241 gacataaacc ctcctcctga gacccttgat accccagggg tggttgtgga aagcggcaga
 301 ggtgggaaaa aattgcctga tctgggagca gctgaaatgg acttgcgttg ttatgaagag
 361 ggttttcctc cgagtgatga tgaagacggg gaaactgaac agtccatcca taccgcagtg
 421 aatgagggag taaaagctgc cagcgatgtt tttaagttgg actgtccgga gctgcctgga
 481 catggctgta agtcttgtga atttcacagg aataacactg gaatgaaaga actattgtgc
 541 tcgctttgct atatgagaat gcactgccac tttatttaca gtcctgtgtc tgatgatgag
 601 tcaccttctc ctgattcaac tacctcacct cctgaaattc aggcgcccgt acctgcaaac
 661 gtatgcaagc ccattcctgt gaagcctaag tctgggaaac gccctgctgt ggataagctt
 721 gaggacttgt tggagggtgg ggatggacct ttggacctta gtacccggaa actgccaagg
 781 caatga
//