LOCUS AY601636 699 bp DNA linear VRL 12-APR-2006
DEFINITION Human adenovirus type 16 strain ch. 79, complete genome.
ACCESSION AY601636 REGION: 17586..18284
VERSION AY601636.1 GI:57116031
KEYWORDS .
SOURCE Human adenovirus 16
 ORGANISM Human adenovirus 16
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 699)
 AUTHORS Lin,B., Wang,Z., Vora,G.J., Thornton,J.A., Schnur,J.M., Thach,D.C.,
 Blaney,K.M., Ligler,A.G., Malanoski,A.P., Santiago,J., Walter,E.A.,
 Agan,B.K., Metzgar,D., Seto,D., Daum,L.T., Kruzelock,R.,
 Rowley,R.K., Hanson,E.H., Tibbetts,C. and Stenger,D.A.
 TITLE Broad-spectrum respiratory tract pathogen identification using
 resequencing DNA microarrays
 JOURNAL Genome Res. 16 (4), 527-535 (2006)
 PUBMED 16481660
REFERENCE 2 (bases 1 to 699)
 AUTHORS Tibbetts,C., Purkayastha,A., Su,J., Carlisle,S., Ospina,R.,
 Reynolds,T., Rowley,R., Hanson,E. and Seto,D.
 CONSRTM Epidemic Outbreak Surveillance (EOS)
 TITLE The complete nucleotide sequence and genome organization of Human
 Adenovirus Serotype 16
 JOURNAL Unpublished
REFERENCE 3 (bases 1 to 699)
 AUTHORS Tibbetts,C., Purkayastha,A., Su,J., Carlisle,S., Ospina,R.,
 Reynolds,T., Rowley,R., Hanson,E. and Seto,D.
 CONSRTM Epidemic Outbreak Surveillance (EOS)
 TITLE Direct Submission
 JOURNAL Submitted (16-APR-2004) Modernization Directorate (SGR), USAF
 Surgeon General Office HQ, 5201 Leesburg Pike, Suite 1401, Falls
 Church, VA 22041, USA
FEATURES Location/Qualifiers
 source  1..699
 /organism="Human adenovirus 16"
 /mol_type="genomic DNA"
 /strain="ch. 79"
 /serotype="16"
 /db_xref="taxon:31544"
 gene 1..>699
 /gene="L3"
 CDS 1..699
 /gene="L3"
 /codon_start=1
 /product="protein VI precursor"
 /protein_id="AAW33443.1"
 /db_xref="GI:57116050"
 /translation="MEDINFSSLAPRHGTRPYMGTWSDIGTSQLNGGAFNWSSIWSGL
 KNFGSTIKTYGNKAWNSSTGQALRNKLKEQNFQQKVVDGIASGINGVVDLANQAVQKQ
 INSRLDPPPATPGEMEVEEELPPLEKRGDKRPRPELEQTLVTRADEPPSYEEAVKLGM
 PTTRPVAHMATGVMKPSQSHRPATLDLPPPPASAAPIPKPVATRKPTAVQPVAVARPR
  PGAHRARKQTGRVL"
ORIGIN 
 1 atggaagaca tcaatttttc atccctggct ccgcgacacg gcacgaggcc gtacatgggc
 61 acctggagcg acatcggcac gagccaactg aacgggggcg ccttcaattg gagcagtatc
 121 tggagcgggc ttaaaaattt tggctcgacc ataaaaacct atgggaacaa agcttggaac
 181 agcagcacag ggcaggccct tagaaataag cttaaggagc agaacttcca acaaaaggtg
 241 gtcgatggta tcgcctctgg tattaacggc gtagtggatc tagccaacca ggctgtgcag
 301 aaacagataa acagccgcct ggacccgccg cccgcaactc ctggtgaaat ggaagtggag
 361 gaagagcttc ctccgctgga gaagcggggc gacaagcgac cgcgtcccga gctggaacag
 421 acgttggtga cgcgcgcaga cgagccccct tcatacgagg aggcagtaaa gctcggaatg
 481 cccactacca ggcctgtagc tcacatggct accggggtga tgaaaccttc tcagtcgcat
 541 cggcctgcca ccttggactt gcctcctccc cctgcttctg cggcgcctat tcccaaacct
 601 gtcgctacca gaaagcccac cgccgtacag cccgtcgccg tagccagacc gcgtcctggg
 661 gcacaccgcg cccgaaagca aactggcaga gtactctga
//