LOCUS AY601636 228 bp DNA linear VRL 12-APR-2006
DEFINITION Human adenovirus type 16 strain ch. 79, complete genome.
ACCESSION AY601636 REGION: 17284..17511
VERSION AY601636.1 GI:57116031
KEYWORDS .
SOURCE Human adenovirus 16
 ORGANISM Human adenovirus 16
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 228)
 AUTHORS Lin,B., Wang,Z., Vora,G.J., Thornton,J.A., Schnur,J.M., Thach,D.C.,
 Blaney,K.M., Ligler,A.G., Malanoski,A.P., Santiago,J., Walter,E.A.,
 Agan,B.K., Metzgar,D., Seto,D., Daum,L.T., Kruzelock,R.,
 Rowley,R.K., Hanson,E.H., Tibbetts,C. and Stenger,D.A.
 TITLE Broad-spectrum respiratory tract pathogen identification using
 resequencing DNA microarrays
 JOURNAL Genome Res. 16 (4), 527-535 (2006)
 PUBMED 16481660
REFERENCE 2 (bases 1 to 228)
 AUTHORS Tibbetts,C., Purkayastha,A., Su,J., Carlisle,S., Ospina,R.,
 Reynolds,T., Rowley,R., Hanson,E. and Seto,D.
 CONSRTM Epidemic Outbreak Surveillance (EOS)
 TITLE The complete nucleotide sequence and genome organization of Human
 Adenovirus Serotype 16
 JOURNAL Unpublished
REFERENCE 3 (bases 1 to 228)
 AUTHORS Tibbetts,C., Purkayastha,A., Su,J., Carlisle,S., Ospina,R.,
 Reynolds,T., Rowley,R., Hanson,E. and Seto,D.
 CONSRTM Epidemic Outbreak Surveillance (EOS)
 TITLE Direct Submission
 JOURNAL Submitted (16-APR-2004) Modernization Directorate (SGR), USAF
 Surgeon General Office HQ, 5201 Leesburg Pike, Suite 1401, Falls
 Church, VA 22041, USA
FEATURES Location/Qualifiers
 source  1..228
 /organism="Human adenovirus 16"
 /mol_type="genomic DNA"
 /strain="ch. 79"
 /serotype="16"
 /db_xref="taxon:31544"
 gene <1..>228
 /gene="L2"
 CDS 1..228
 /gene="L2"
 /codon_start=1
 /product="protein X"
 /protein_id="AAW33442.1"
 /db_xref="GI:57116049"
 /translation="MALTCRLRVPITGYRGRNSRRRRMLGRGMRRHRRRRAISKRLGG
  GFLPALIPIIAAAIGAIPGIASVAVQASQRH"
ORIGIN 
 1 atggctctca cttgccgcct tcgcgtcccc attactggct accgaggaag aaactcgcgc
 61 cgtagaagga tgttggggcg agggatgcgc cgccacagac gaaggcgcgc tatcagcaag
 121 cgattagggg gtggctttct gccagctctt atacccatca tcgccgcggc gatcggggcg
 181 ataccaggca tagcttccgt ggcggttcag gcctcgcagc gccactaa
//