LOCUS AY601633 417 bp DNA linear VRL 10-MAY-2006
DEFINITION Human adenovirus type 21 strain AV-1645, complete genome.
ACCESSION AY601633 REGION: 3477..3893
VERSION AY601633.1 GI:57115934
KEYWORDS .
SOURCE Human adenovirus 21
 ORGANISM Human adenovirus 21
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 417)
 AUTHORS Lin,B., Wang,Z., Vora,G.J., Thornton,J.A., Schnur,J.M., Thach,D.C.,
 Blaney,K.M., Ligler,A.G., Malanoski,A.P., Santiago,J., Walter,E.A.,
 Agan,B.K., Metzgar,D., Seto,D., Daum,L.T., Kruzelock,R.,
 Rowley,R.K., Hanson,E.H., Tibbetts,C. and Stenger,D.A.
 TITLE Broad-spectrum respiratory tract pathogen identification using
 resequencing DNA microarrays
 JOURNAL Genome Res. 16 (4), 527-535 (2006)
 PUBMED 16481660
REFERENCE 2 (bases 1 to 417)
 AUTHORS Tibbetts,C., Purkayastha,A., Su,J., Carlisle,S., Ospina,R.,
 Reynolds,T., Rowley,R., Hanson,E. and Seto,D.
 CONSRTM Epidemic Outbreak Surveillance (EOS)
 TITLE The complete nucleotide sequence and genome organization of Human
 Adenovirus Serotype 21
 JOURNAL Unpublished
REFERENCE 3 (bases 1 to 417)
 AUTHORS Tibbetts,C., Purkayastha,A., Su,J., Carlisle,S., Ospina,R.,
 Reynolds,T., Rowley,R., Hanson,E. and Seto,D.
 CONSRTM Epidemic Outbreak Surveillance (EOS)
 TITLE Direct Submission
 JOURNAL Submitted (16-APR-2004) Modernization Directorate (SGR), USAF
 Surgeon General Office HQ, 5201 Leesburg Pike, Suite 1401, Falls
 Church, VA 22041, USA
FEATURES Location/Qualifiers
 source 1..417
 /organism="Human adenovirus 21"
 /mol_type="genomic DNA"
 /strain="AV-1645"
 /serotype="21"
 /db_xref="taxon:32608"
 gene 1..>417
 /gene="IX"
 CDS 1..417
 /gene="IX"
 /codon_start=1
 /product="hexon-associated protein IX"
 /protein_id="AAW33335.1"
 /db_xref="GI:57115940"
 /translation="MSGSASFEGGVFSPYLTGRLPSWAGVRQNVMGSTVDGRPVQPAN
 SSTLTYATLSSSSLDAAAAAAATAAANTILGMGYYGSIVANSSSSNNPSTLAEDKLLV
 LLAQLEALTQRLGELSKQVAQLREQTESAVATAKSK"
ORIGIN 
 1 atgagtggaa gcgcttcttt tgagggggga gtatttagcc cttatctgac gggcaggctc
 61 ccatcatggg caggagttcg tcagaatgtc atgggatcca ctgtggatgg gagacccgtc
 121 cagcccgcca attcctcaac gctgacctat gccactttga gttcgtcatc attggatgca
 181 gctgcagccg ccgccgctac tgctgccgcc aacaccatcc ttggaatggg ctattacgga
 241 agcatcgttg ccaattccag ttcctctaat aacccttcaa ccctggctga ggacaagctg
 301 cttgttctct tggctcagct cgaggcctta acccaacgct taggcgaact gtctaagcag
 361 gtggcccagt tgcgtgagca aactgagtct gctgttgcca cagcaaagtc taaataa
//