LOCUS       AY601633                 630 bp    DNA     linear   VRL 10-MAY-2006
DEFINITION  Human adenovirus type 21 strain AV-1645, complete genome.
ACCESSION   AY601633 REGION: 21340..21969
VERSION     AY601633.1  GI:57115934
KEYWORDS    .
SOURCE      Human adenovirus 21
  ORGANISM  Human adenovirus 21
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE   1  (bases 1 to 630)
  AUTHORS   Lin,B., Wang,Z., Vora,G.J., Thornton,J.A., Schnur,J.M., Thach,D.C.,
            Blaney,K.M., Ligler,A.G., Malanoski,A.P., Santiago,J., Walter,E.A.,
            Agan,B.K., Metzgar,D., Seto,D., Daum,L.T., Kruzelock,R.,
            Rowley,R.K., Hanson,E.H., Tibbetts,C. and Stenger,D.A.
  TITLE     Broad-spectrum respiratory tract pathogen identification using
            resequencing DNA microarrays
  JOURNAL   Genome Res. 16 (4), 527-535 (2006)
   PUBMED   16481660
REFERENCE   2  (bases 1 to 630)
  AUTHORS   Tibbetts,C., Purkayastha,A., Su,J., Carlisle,S., Ospina,R.,
            Reynolds,T., Rowley,R., Hanson,E. and Seto,D.
  CONSRTM   Epidemic Outbreak Surveillance (EOS)
  TITLE     The complete nucleotide sequence and genome organization of Human
            Adenovirus Serotype 21
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 630)
  AUTHORS   Tibbetts,C., Purkayastha,A., Su,J., Carlisle,S., Ospina,R.,
            Reynolds,T., Rowley,R., Hanson,E. and Seto,D.
  CONSRTM   Epidemic Outbreak Surveillance (EOS)
  TITLE     Direct Submission
  JOURNAL   Submitted (16-APR-2004) Modernization Directorate (SGR), USAF
            Surgeon General Office HQ, 5201 Leesburg Pike, Suite 1401, Falls
            Church, VA 22041, USA
FEATURES             Location/Qualifiers
     source          1..630
                     /organism="Human adenovirus 21"
                     /mol_type="genomic DNA"
                     /strain="AV-1645"
                     /serotype="21"
                     /db_xref="taxon:32608"
     gene            <1..>630
                     /gene="L3"
     CDS             1..630
                     /gene="L3"
                     /note="adenain"
                     /codon_start=1
                     /product="23 kDa proteinase"
                     /protein_id="AAW33355.1"
                     /db_xref="GI:57115960"
                     /translation="MSCGSGNGSSEQELKAIVRDLGCGPYFLGTFDKRFPGFMAPDKL
                     ACAIVNTAGRETGGEHWLAFGWNPRSNTCYLFDPFGFSDERLKQIYQFEYEGLLRRSA
                     LATKDRCITLEKSTQSVQGPRSAACGLFCCMFLHAFVHWPDRPMNGNPTMKLLTGVSN
                     SMLQSPQVQPTLRRNQEALYRFLNTHSSYFRSHRARIERATAFDRMDMQ"
ORIGIN      
        1 atgtcatgcg ggtccggaaa cggctccagc gagcaagagc tcaaagccat cgtccgagac
       61 ctgggctgcg gaccctattt cctgggaacc tttgacaagc gtttcccggg gttcatggcc
      121 cccgacaagc tcgcctgcgc catagtcaac actgccggac gcgagacggg gggagagcac
      181 tggctggctt ttggttggaa cccgcgctcc aacacctgct acctttttga tccttttggg
      241 ttctcggatg agcgactcaa acagatttac cagtttgagt acgaggggct cctgcgccgc
      301 agtgcccttg ctaccaaaga ccgctgcatc accctggaaa agtccaccca gagcgtgcag
      361 ggcccgcgct cagccgcctg tggacttttt tgctgtatgt tccttcatgc ctttgtgcac
      421 tggcccgacc gccccatgaa cggaaacccc accatgaagt tgctgactgg ggtgtcaaac
      481 agcatgctcc aatcacccca agtccagccc accctgcgtc gcaaccagga ggcgctatat
      541 cgcttcctaa acacccactc atcttacttt cgttctcacc gcgcacgcat cgaaagggcc
      601 accgcgtttg accgtatgga tatgcaataa
//