LOCUS       AY601633                1170 bp    DNA     linear   VRL 10-MAY-2006
DEFINITION  Human adenovirus type 21 strain AV-1645, complete genome.
ACCESSION   AY601633 REGION: 10857..12026
VERSION     AY601633.1  GI:57115934
KEYWORDS    .
SOURCE      Human adenovirus 21
  ORGANISM  Human adenovirus 21
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE   1  (bases 1 to 1170)
  AUTHORS   Lin,B., Wang,Z., Vora,G.J., Thornton,J.A., Schnur,J.M., Thach,D.C.,
            Blaney,K.M., Ligler,A.G., Malanoski,A.P., Santiago,J., Walter,E.A.,
            Agan,B.K., Metzgar,D., Seto,D., Daum,L.T., Kruzelock,R.,
            Rowley,R.K., Hanson,E.H., Tibbetts,C. and Stenger,D.A.
  TITLE     Broad-spectrum respiratory tract pathogen identification using
            resequencing DNA microarrays
  JOURNAL   Genome Res. 16 (4), 527-535 (2006)
   PUBMED   16481660
REFERENCE   2  (bases 1 to 1170)
  AUTHORS   Tibbetts,C., Purkayastha,A., Su,J., Carlisle,S., Ospina,R.,
            Reynolds,T., Rowley,R., Hanson,E. and Seto,D.
  CONSRTM   Epidemic Outbreak Surveillance (EOS)
  TITLE     The complete nucleotide sequence and genome organization of Human
            Adenovirus Serotype 21
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 1170)
  AUTHORS   Tibbetts,C., Purkayastha,A., Su,J., Carlisle,S., Ospina,R.,
            Reynolds,T., Rowley,R., Hanson,E. and Seto,D.
  CONSRTM   Epidemic Outbreak Surveillance (EOS)
  TITLE     Direct Submission
  JOURNAL   Submitted (16-APR-2004) Modernization Directorate (SGR), USAF
            Surgeon General Office HQ, 5201 Leesburg Pike, Suite 1401, Falls
            Church, VA 22041, USA
FEATURES             Location/Qualifiers
     source          1..1170
                     /organism="Human adenovirus 21"
                     /mol_type="genomic DNA"
                     /strain="AV-1645"
                     /serotype="21"
                     /db_xref="taxon:32608"
     gene            complement(<1..>1170)
                     /gene="E2B"
     gene            <1..>1170
                     /gene="L1"
     CDS             1..1170
                     /gene="L1"
                     /codon_start=1
                     /product="52 kDa protein"
                     /protein_id="AAW33347.1"
                     /db_xref="GI:57115952"
                     /translation="MHPVLRQMRPQQQPPSQQQLQQQPQKALPAPVTTAAAAVSGAGQ
                     PAYDLDLEEGEGLARLGAPSPERHPRVQLKKDSREAYVPQQNLFRDRSGEEPEEMRAS
                     RFNAGRELRHGLDRRRVLRDDDFEVDEVTGISPARAHVAAANLVSAYEQTVKEERNFQ
                     KSFNNHVRTLIAREEVTLGLMHLWDLMEAITQNPTSKPLTAQLFLVVQHSRDNEAFRE
                     ALLNITEPEGRWLYDLINILQSIIVQERSLGLAEKVAAINYSVLSLGKHYARKIYKTP
                     YVPIDKEVKIDGFYMRMTLKVLTLSDDLGVYRNDRMHRAVSASRRRELSDRELMHSLQ
                     RALTGAGTEGENYFDMGADLQWQPSRRALDAAGYELPYIEEVDEGQDEEGEYLED"
ORIGIN      
        1 atgcatcccg tgctgcgaca gatgcgcccc cagcaacagc ccccttctca gcagcagcta
       61 caacaacagc cacaaaaggc tcttcctgct cctgtaacta ctgcggctgc agccgtcagc
      121 ggcgcggggc agcccgccta tgatctggac ttggaagagg gcgagggact ggcgcgcctg
      181 ggcgcaccat cgcccgagcg gcacccgcgg gtgcaactga aaaaggactc tcgcgaggcg
      241 tacgtgcccc agcagaacct gttcagggac aggagcggcg aggagcctga ggaaatgcga
      301 gcttcccgct ttaacgcggg tcgcgaactg cgtcacggtc tggaccgaag acgggtgctg
      361 cgtgatgatg attttgaagt cgatgaagtg acaggaataa gtcctgctag ggcacatgtg
      421 gccgcggcca acctagtatc agcttacgag cagaccgtga aggaggagcg caactttcaa
      481 aaatctttca acaaccatgt gcgcaccctg attgcccgcg aggaagtgac actgggactg
      541 atgcacctgt gggacctgat ggaagccatt acccagaacc ccaccagcaa acctctaacc
      601 gctcagctgt ttctggtggt gcaacatagt agagacaatg aggcatttag ggaggcgctg
      661 ttgaacatta ctgagcccga ggggagatgg ttgtatgatc ttatcaatat tctgcaaagt
      721 ataatagtgc aagaacgtag cctgggtcta gctgagaagg tggctgctat taactactcg
      781 gtcttgagcc tgggcaagca ctacgctcgc aagatctaca aaaccccata cgtacctata
      841 gacaaggagg tgaagataga tgggttttat atgcgcatga ctctcaaggt gctgaccttg
      901 agtgacgatc tgggagtgta ccgcaacgac aggatgcacc gcgcagtgag cgccagcaga
      961 aggcgtgagc tgagcgacag agaacttatg cacagcttgc aaagagctct gactggggct
     1021 ggaaccgagg gggagaacta ctttgacatg ggagcggact tgcaatggca gcccagtcgc
     1081 agggccctgg acgcagcagg gtatgagctt ccttacatag aagaggtgga tgaaggccag
     1141 gatgaggagg gcgagtacct ggaagactga
//