LOCUS AY601633 750 bp DNA linear VRL 10-MAY-2006
DEFINITION Human adenovirus type 21 strain AV-1645, complete genome.
ACCESSION AY601633 REGION: 17583..18332
VERSION AY601633.1 GI:57115934
KEYWORDS .
SOURCE Human adenovirus 21
 ORGANISM Human adenovirus 21
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 750)
 AUTHORS Lin,B., Wang,Z., Vora,G.J., Thornton,J.A., Schnur,J.M., Thach,D.C.,
 Blaney,K.M., Ligler,A.G., Malanoski,A.P., Santiago,J., Walter,E.A.,
 Agan,B.K., Metzgar,D., Seto,D., Daum,L.T., Kruzelock,R.,
 Rowley,R.K., Hanson,E.H., Tibbetts,C. and Stenger,D.A.
 TITLE Broad-spectrum respiratory tract pathogen identification using
 resequencing DNA microarrays
 JOURNAL Genome Res. 16 (4), 527-535 (2006)
 PUBMED 16481660
REFERENCE 2 (bases 1 to 750)
 AUTHORS Tibbetts,C., Purkayastha,A., Su,J., Carlisle,S., Ospina,R.,
  Reynolds,T., Rowley,R., Hanson,E. and Seto,D.
 CONSRTM Epidemic Outbreak Surveillance (EOS)
 TITLE The complete nucleotide sequence and genome organization of Human
 Adenovirus Serotype 21
 JOURNAL Unpublished
REFERENCE 3 (bases 1 to 750)
 AUTHORS Tibbetts,C., Purkayastha,A., Su,J., Carlisle,S., Ospina,R.,
 Reynolds,T., Rowley,R., Hanson,E. and Seto,D.
 CONSRTM Epidemic Outbreak Surveillance (EOS)
 TITLE Direct Submission
 JOURNAL Submitted (16-APR-2004) Modernization Directorate (SGR), USAF
 Surgeon General Office HQ, 5201 Leesburg Pike, Suite 1401, Falls
 Church, VA 22041, USA
FEATURES Location/Qualifiers
 source 1..750
 /organism="Human adenovirus 21"
 /mol_type="genomic DNA"
 /strain="AV-1645"
 /serotype="21"
 /db_xref="taxon:32608"
 gene 1..>750
 /gene="L3"
 CDS 1..750
 /gene="L3"
 /note="hexon-associated protein"
 /codon_start=1
 /product="protein VI precursor"
 /protein_id="AAW33353.1"
 /db_xref="GI:57115958"
 /translation="MEDINFSSLAPRHGTRPYMGTWSDIGTSQLNGGAFNWSSIWSGL
 KNFGSTIKTYGNKAWNSSTGQALRNKLKEQNFQQKVVDGIASGINGVVDLANQAVQKQ
 INSRIDPPPSAPGEMEVEEDLPPLEKRGDKRPRPDLEETLVTRSDDPPSYEEAVKLGM
 PTTRPVAPMATGVMKPSQSHRPATLDLPPPAVAAPARKPVATPKPTTVQPVAVARPRP
 GGTPRPNANWQSTLNSIVGLGVQSVKRRRCF"
ORIGIN 
 1 atggaagaca tcaatttttc atccctggct ccgcgacacg gcacgaggcc gtacatgggc
 61 acctggagcg acatcggcac cagccaactg aacgggggcg ccttcaattg gagcagtatc
 121 tggagcgggc ttaaaaattt tggctctacc ataaaaacct atgggaacaa agcttggaac
 181 agcagcacag ggcaggcatt gagaaataag cttaaagagc aaaacttcca acagaaggtg
 241 gttgatggaa tcgcctctgg tatcaatggg gtggtggatc tggccaacca ggccgtgcag
 301 aaacagataa acagccgcat tgacccgccg ccgtcagccc cgggtgaaat ggaagtggag
 361 gaagatctcc ctccccttga aaagcggggc gacaagcgtc cgcgccccga tctggaggag
 421 acactagtca cacgctcaga cgacccgccc tcctacgagg aggcagtgaa gcttggaatg
 481 cccaccacca gacctgtagc ccccatggct accggggtaa tgaaaccttc tcagtcacac
 541 cgacccgcta ccttggactt gcctccccct gctgttgcag cgcctgctcg caagcctgtc
 601 gctaccccga agcccaccac cgtacagccc gtcgccgtag ccagaccgcg tcctgggggc
 661 actccacgtc cgaatgcaaa ctggcagagt actctgaaca gcatcgtggg tctgggcgtg
 721 caaagtgtaa agcgccgtcg ctgcttttaa
//