LOCUS AY601633 231 bp DNA linear VRL 10-MAY-2006
DEFINITION Human adenovirus type 21 strain AV-1645, complete genome.
ACCESSION AY601633 REGION: 17280..17510
VERSION AY601633.1 GI:57115934
KEYWORDS .
SOURCE Human adenovirus 21
ORGANISM Human adenovirus 21
Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 231)
AUTHORS Lin,B., Wang,Z., Vora,G.J., Thornton,J.A., Schnur,J.M., Thach,D.C.,
Blaney,K.M., Ligler,A.G., Malanoski,A.P., Santiago,J., Walter,E.A.,
Agan,B.K., Metzgar,D., Seto,D., Daum,L.T., Kruzelock,R.,
Rowley,R.K., Hanson,E.H., Tibbetts,C. and Stenger,D.A.
TITLE Broad-spectrum respiratory tract pathogen identification using
resequencing DNA microarrays
JOURNAL Genome Res. 16 (4), 527-535 (2006)
PUBMED 16481660
REFERENCE 2 (bases 1 to 231)
AUTHORS Tibbetts,C., Purkayastha,A., Su,J., Carlisle,S., Ospina,R.,
Reynolds,T., Rowley,R., Hanson,E. and Seto,D.
CONSRTM Epidemic Outbreak Surveillance (EOS)
TITLE The complete nucleotide sequence and genome organization of Human
Adenovirus Serotype 21
JOURNAL Unpublished
REFERENCE 3 (bases 1 to 231)
AUTHORS Tibbetts,C., Purkayastha,A., Su,J., Carlisle,S., Ospina,R.,
Reynolds,T., Rowley,R., Hanson,E. and Seto,D.
CONSRTM Epidemic Outbreak Surveillance (EOS)
TITLE Direct Submission
JOURNAL Submitted (16-APR-2004) Modernization Directorate (SGR), USAF
Surgeon General Office HQ, 5201 Leesburg Pike, Suite 1401, Falls
Church, VA 22041, USA
FEATURES Location/Qualifiers
source 1..231
/organism="Human adenovirus 21"
/mol_type="genomic DNA"
/strain="AV-1645"
/serotype="21"
/db_xref="taxon:32608"
gene <1..>231
/gene="L2"
CDS 1..231
/gene="L2"
/note="protein mu"
/codon_start=1
/product="protein X"
/protein_id="AAW33352.1"
/db_xref="GI:57115957"
/translation="MALTCRLRVPITGYRGRNSRRRRGMLGRGMRRHRRRRAISKRLG
GGFLPALIPIIAAAIGAIPGIASVAVQASQRH"
ORIGIN
1 atggccctca cttgccgcct tcgtgtcccc attactggct accgaggaag aaactcgcgc
61 cgtagaagag ggatgttggg gcgcggaatg cgacgccaca ggcggcggcg cgctatcagc
121 aagaggctgg ggggtggctt tctgcctgct ctgatcccca tcatagccgc ggcgatcggg
181 gcgataccag gcatagcttc cgtggcggtt caggcctcgc agcgccactg a
//