LOCUS       AY601633                 231 bp    DNA     linear   VRL 10-MAY-2006
DEFINITION  Human adenovirus type 21 strain AV-1645, complete genome.
ACCESSION   AY601633 REGION: 17280..17510
VERSION     AY601633.1  GI:57115934
KEYWORDS    .
SOURCE      Human adenovirus 21
  ORGANISM  Human adenovirus 21
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE   1  (bases 1 to 231)
  AUTHORS   Lin,B., Wang,Z., Vora,G.J., Thornton,J.A., Schnur,J.M., Thach,D.C.,
            Blaney,K.M., Ligler,A.G., Malanoski,A.P., Santiago,J., Walter,E.A.,
            Agan,B.K., Metzgar,D., Seto,D., Daum,L.T., Kruzelock,R.,
            Rowley,R.K., Hanson,E.H., Tibbetts,C. and Stenger,D.A.
  TITLE     Broad-spectrum respiratory tract pathogen identification using
            resequencing DNA microarrays
  JOURNAL   Genome Res. 16 (4), 527-535 (2006)
   PUBMED   16481660
REFERENCE   2  (bases 1 to 231)
  AUTHORS   Tibbetts,C., Purkayastha,A., Su,J., Carlisle,S., Ospina,R.,
            Reynolds,T., Rowley,R., Hanson,E. and Seto,D.
  CONSRTM   Epidemic Outbreak Surveillance (EOS)
  TITLE     The complete nucleotide sequence and genome organization of Human
            Adenovirus Serotype 21
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 231)
  AUTHORS   Tibbetts,C., Purkayastha,A., Su,J., Carlisle,S., Ospina,R.,
            Reynolds,T., Rowley,R., Hanson,E. and Seto,D.
  CONSRTM   Epidemic Outbreak Surveillance (EOS)
  TITLE     Direct Submission
  JOURNAL   Submitted (16-APR-2004) Modernization Directorate (SGR), USAF
            Surgeon General Office HQ, 5201 Leesburg Pike, Suite 1401, Falls
            Church, VA 22041, USA
FEATURES             Location/Qualifiers
     source          1..231
                     /organism="Human adenovirus 21"
                     /mol_type="genomic DNA"
                     /strain="AV-1645"
                     /serotype="21"
                     /db_xref="taxon:32608"
     gene            <1..>231
                     /gene="L2"
     CDS             1..231
                     /gene="L2"
                     /note="protein mu"
                     /codon_start=1
                     /product="protein X"
                     /protein_id="AAW33352.1"
                     /db_xref="GI:57115957"
                     /translation="MALTCRLRVPITGYRGRNSRRRRGMLGRGMRRHRRRRAISKRLG
                     GGFLPALIPIIAAAIGAIPGIASVAVQASQRH"
ORIGIN      
        1 atggccctca cttgccgcct tcgtgtcccc attactggct accgaggaag aaactcgcgc
       61 cgtagaagag ggatgttggg gcgcggaatg cgacgccaca ggcggcggcg cgctatcagc
      121 aagaggctgg ggggtggctt tctgcctgct ctgatcccca tcatagccgc ggcgatcggg
      181 gcgataccag gcatagcttc cgtggcggtt caggcctcgc agcgccactg a
//