LOCUS DQ086466 417 bp DNA linear VRL 23-NOV-2005
DEFINITION Human adenovirus type 3, complete genome.
ACCESSION DQ086466 REGION: 3480..3896
VERSION DQ086466.1 GI:78059380
KEYWORDS .
SOURCE Human adenovirus 3
 ORGANISM Human adenovirus 3
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 417)
 AUTHORS Sirena,D., Ruzsics,Z., Schaffner,W., Greber,U.F. and Hemmi,S.
 TITLE The nucleotide sequence and a first generation gene transfer vector
  of species B human adenovirus serotype 3
 JOURNAL Virology 343 (2), 283-298 (2005)
 PUBMED 16169033
REFERENCE 2 (bases 1 to 417)
 AUTHORS Hemmi,S., Greber,U.F., Schaffner,W. and Sirena,D.
 TITLE Direct Submission
 JOURNAL Submitted (06-JUN-2005) Institute of Molecular Biology, University
 of Zurich, Winterthurerstrasse 190, Zurich 8057, Switzerland
FEATURES  Location/Qualifiers
 source 1..417
 /organism="Human adenovirus 3"
 /mol_type="genomic DNA"
 /db_xref="taxon:45659"
 gene <1..>417
 /gene="IX"
 CDS 1..417
 /gene="IX"
 /codon_start=1
 /product="protein IX"
 /protein_id="ABB17776.1"
 /db_xref="GI:78059390"
 /translation="MSGSASFEGGVFSPYLTGRLPPWAGVRQNVMGSTVDGRPVQPAN
 SSTLTYATLSSSPLDAAAAAAATAAANTILGMGYYGSIVANSSSSNNPSTLAEDKLLV
 LLAQLEALTQRLGELSKQVAQLREQTESAVATAKSK"
ORIGIN 
 1 atgagtggaa gcgcttcttt tgagggggga gtatttagcc cttatctgac gggcaggctc
 61 ccaccatggg caggagttcg tcagaatgtc atgggatcca ctgtggatgg gagacccgtc
 121 cagcccgcca attcctcaac gctgacctat gccactttga gttcgtcacc attggatgca
 181 gctgcagccg ccgccgctac tgctgccgcc aacaccatcc ttggaatggg ctattatgga
 241 agcatcgttg ccaattccag ttcctctaat aacccttcaa ccctggctga ggacaagcta
 301 cttgttctct tggcgcagct cgaggcctta acccaacgct taggcgaact gtctaagcag
 361 gtggcccagt tgcgtgagca aactgagtct gctgttgcca cagcaaagtc taaataa
//