LOCUS       AY737797                 630 bp    DNA     linear   VRL 27-DEC-2005
DEFINITION  Human adenovirus type 34 strain Compton, complete genome.
ACCESSION   AY737797 REGION: 21136..21765
VERSION     AY737797.1  GI:57115661
KEYWORDS    .
SOURCE      Human adenovirus 34
  ORGANISM  Human adenovirus 34
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE   1  (bases 1 to 630)
  AUTHORS   Tibbetts,C., Purkayastha,A., Clark,J., Carlisle,S., Rowley,R.,
            Hanson,E. and Seto,D.
  CONSRTM   Epidemic Outbreak Surveillance (EOS)
  TITLE     The complete nucleotide sequence and genome organization of Human
            Adenovirus Serotype 34
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 630)
  AUTHORS   Tibbetts,C., Purkayastha,A., Clark,J., Carlisle,S., Reynolds,T.,
            Rowley,R., Hanson,E. and Seto,D.
  CONSRTM   Epidemic Outbreak Surveillance (EOS)
  TITLE     Direct Submission
  JOURNAL   Submitted (30-AUG-2004) Modernization Directorate (SGR), USAF
            Surgeon General Office HQ, 5201 Leesburg Pike, Suite 1401, Falls
            Church, VA 22041, USA
FEATURES             Location/Qualifiers
     source          1..630
                     /organism="Human adenovirus 34"
                     /mol_type="genomic DNA"
                     /strain="Compton; ATCC VR-716"
                     /serotype="34"
                     /db_xref="ATCC:VR-716"
                     /db_xref="taxon:10548"
     gene            <1..>630
                     /gene="L3"
     CDS             1..630
                     /gene="L3"
                     /codon_start=1
                     /product="23 kDa protein"
                     /protein_id="AAW33486.1"
                     /db_xref="GI:57115679"
                     /translation="MACGSQNGSSEQELRAIVQDLGCGPYFLGTFDKRFPGFMAPDKL
                     ACAIVNTAGRETGGEHWLAFGWNPRSNTCYLFDPFGFSDDRLKQIYQFEYEGLLRRSA
                     LATKDRCITLEKSTQTVQGPRSAACGLFCCMFLHAFVHWPDRPMDGNPTMKLLTGVPN
                     NMLHSPKVQPTLCDNQKALYHFLNTHSPYFRSHRTHIERATAFDRMDVQ"
ORIGIN      
        1 atggcctgcg gatcccaaaa cggctccagc gagcaagagc tcagagccat tgtccaagac
       61 ctgggttgcg gaccatattt tttgggaacc tttgataagc gcttcccggg gttcatggcc
      121 cccgataagc tcgcctgtgc cattgtaaat acggccggac gtgagacggg gggagagcac
      181 tggttggctt tcggttggaa cccacgttct aacacctgct acctttttga tccttttgga
      241 ttctcggatg atcgtctcaa acagatttac cagtttgaat atgagggtct cctgcgccgc
      301 agcgctcttg ctaccaagga ccggtgtatt acgctggaaa aatctaccca gaccgtgcag
      361 ggcccccgtt ctgccgcctg cggacttttc tgctgcatgt tccttcatgc ctttgtgcac
      421 tggcctgacc gtcccatgga cggaaacccc accatgaaat tgctaactgg agtgccaaac
      481 aacatgcttc attctcctaa agtccagccc accctgtgtg acaatcaaaa agcactctac
      541 cattttctca atacccattc gccttatttt cgctctcatc gtacacacat cgaaagggcc
      601 actgcgttcg accgtatgga tgtgcaataa
//