LOCUS       AY737797                 684 bp    DNA     linear   VRL 27-DEC-2005
DEFINITION  Human adenovirus type 34 strain Compton, complete genome.
ACCESSION   AY737797 REGION: join(25600..25921,26091..26452)
VERSION     AY737797.1  GI:57115661
KEYWORDS    .
SOURCE      Human adenovirus 34
  ORGANISM  Human adenovirus 34
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE   1  (bases 1 to 684)
  AUTHORS   Tibbetts,C., Purkayastha,A., Clark,J., Carlisle,S., Rowley,R.,
            Hanson,E. and Seto,D.
  CONSRTM   Epidemic Outbreak Surveillance (EOS)
  TITLE     The complete nucleotide sequence and genome organization of Human
            Adenovirus Serotype 34
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 684)
  AUTHORS   Tibbetts,C., Purkayastha,A., Clark,J., Carlisle,S., Reynolds,T.,
            Rowley,R., Hanson,E. and Seto,D.
  CONSRTM   Epidemic Outbreak Surveillance (EOS)
  TITLE     Direct Submission
  JOURNAL   Submitted (30-AUG-2004) Modernization Directorate (SGR), USAF
            Surgeon General Office HQ, 5201 Leesburg Pike, Suite 1401, Falls
            Church, VA 22041, USA
FEATURES             Location/Qualifiers
     source          1..684
                     /organism="Human adenovirus 34"
                     /mol_type="genomic DNA"
                     /strain="Compton; ATCC VR-716"
                     /serotype="34"
                     /db_xref="ATCC:VR-716"
                     /db_xref="taxon:10548"
     gene            <1..>684
                     /gene="L4"
     CDS             <1..272
                     /gene="L4"
                     /codon_start=1
                     /product="100 kDa hexon-assembly associated protein"
                     /protein_id="AAW33488.1"
                     /db_xref="GI:57115681"
                     /translation="METQPLLSTSPRVPSHLVLSDEEKEQSLSIPPPSPATTSTLEDK
                     EVDASHDMQNKKAKESEPDIEQDPGYVTPVEHEEELKRFLEREDENCPKQQADNYHQD
                     AGNRDQNTDYLIGLDGEDALLKHLARQSLIVKDALLDRTEVPISVEELSRAYELNLFS
                     PRTPPKRQPNGTCEPNPRLNFYPAFAVPEVLATYHIFFKNQKIPVSCRANRTRADALL
                     NLGPGSRLPDIASLEEVPKIFEGLGNNETRAANALQKGENGMDEHHSVLVELEGDNAR
                     LAVLKRSVEVTHFAYPAVNLPPKVMTAVMDQLLIKRASPLSEDMHDPDACDEGKPVVS
                     DEQLTRWLGTDSPRDLEERRKLMMAVVLVTVELECLRRFFTDSETLRKLEENLHYTFR
                     HGFVRQACKISNVELTNLVSYMGILHENRLGQSVLHSTLKGEARRDYIRDCVYLYLCH
                     TWQTGMGVWQQCLEEQNLKELNKLLQKSLKVLWTGFDERTVASDLADLIFPERLRVTL
                     RNGLPDFMSQSMLNNFRSFILERSGILPATCCALPSDFVPLTYRECPPPLWSHCYLFR
                     LANYLSYHSDVIEDVSGDGLLECHCRCNLCTPHRSLACNPQLMSETQIIGTFELQGPS
                     SQGDGSSPGQSLKLTPGLWTSAYLRKFAPEDYHPYEIKFYEDQSQPPKAELSACVITQ
                     GAILAQLQAIQKSRQEFLLKKGKGVYLDPQTGEELNTRFPQDVPTTRKQEVEGAAAAP
                     RRYGGRLGQSGRGSGGGGQSGGQSGGRQFGGGKRGGRGGGRSNRRQTVILGCGDKQQR
                     YHLRSESRNPAASQQ"
     CDS             1..684
                     /gene="L4"
                     /codon_start=1
                     /product="33 kDa protein"
                     /protein_id="AAW33490.1"
                     /db_xref="GI:57115683"
                     /translation="MSQRRESKKLKVQPPPPEDMEEDWDSQAEEAEEEDSLEDSLEED
                     SLEEENEEAEEVEEVTADKQLSSAAETSNSATISAPSRGTRRRPSSRWDETGRFPNPT
                     SASKTAPTIASKSRQSRQIKTAAATSNRKPAAAVRKYTTSAATGGLKITANEPAQTRE
                     LRNRIFPTLYAIFQQSRGQEQELKIKNRSLRSLTRSCLYHKSEDQLQRTLEDAEALFN
                     KYCALTLKE"
     CDS             1..410
                     /gene="L4"
                     /codon_start=1
                     /product="22 kDa protein"
                     /protein_id="AAW33489.1"
                     /db_xref="GI:57115682"
                     /translation="MSQRRESKKLKVQPPPPEDMEEDWDSQAEEAEEEDSLEDSLEED
                     SLEEENEEAEEVEEVTADKQLSSAAETSNSATISAPSRGTRRRPSSRWDETGRFPNPT
                     SASKTGKKDRQGYKSWRGHKNAIISCLHECGGNISFTRRYLLFHHGVNFPRNVLHYYR
                     HLHSPYYSQQIPAVSTDKDSGGDLQQKTSSGS"
ORIGIN      
        1 atgtcccaac gacgagaaag caagaagttg aaggtgcagc cgccgccccc agaagatatg
       61 gaggaagatt gggacagtca ggcagaggaa gcggaggagg aggacagtct ggaggacagt
      121 ctggaggaag acagtttgga ggaggaaaac gaggaggcag aggaggtgga agaagtaacc
      181 gccgacaaac agttatcctc ggctgcggag acaagcaaca gcgctaccat ctccgctccg
      241 agtcgaggaa cccggcggcg tcccagcagt agatgggacg agaccggacg cttcccgaac
      301 ccaaccagcg cttccaagac cgcccctact atagccagca aatcccggca gtctcgacag
      361 ataaagacag cggcggcgac ctccaacaga aaaccagcag cggcagttag aaaatacaca
      421 acaagtgcag caacaggagg attaaagatt acagccaacg agccagcgca aacccgagag
      481 ttaagaaatc ggatctttcc aaccctgtat gccatcttcc agcagagtcg gggccaagag
      541 caggaactga aaataaaaaa ccgatctctg cgttcgctca ccagaagttg tttgtatcac
      601 aagagcgaag atcaacttca gcgcactctc gaggacgccg aggctctctt caacaagtac
      661 tgcgcgctga ctcttaaaga gtag
//