LOCUS AY737797 1557 bp DNA linear VRL 27-DEC-2005
DEFINITION Human adenovirus type 34 strain Compton, complete genome.
ACCESSION AY737797 REGION: 21843..23399
VERSION AY737797.1 GI:57115661
KEYWORDS .
SOURCE Human adenovirus 34
 ORGANISM Human adenovirus 34
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 1557)
 AUTHORS Tibbetts,C., Purkayastha,A., Clark,J., Carlisle,S., Rowley,R.,
 Hanson,E. and Seto,D.
 CONSRTM Epidemic Outbreak Surveillance (EOS)
 TITLE The complete nucleotide sequence and genome organization of Human
 Adenovirus Serotype 34
 JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1557)
 AUTHORS Tibbetts,C., Purkayastha,A., Clark,J., Carlisle,S., Reynolds,T.,
 Rowley,R., Hanson,E. and Seto,D.
 CONSRTM Epidemic Outbreak Surveillance (EOS)
 TITLE Direct Submission
 JOURNAL Submitted (30-AUG-2004) Modernization Directorate (SGR), USAF
 Surgeon General Office HQ, 5201 Leesburg Pike, Suite 1401, Falls
 Church, VA 22041, USA
FEATURES Location/Qualifiers
 source 1..1557
 /organism="Human adenovirus 34"
  /mol_type="genomic DNA"
 /strain="Compton; ATCC VR-716"
 /serotype="34"
 /db_xref="ATCC:VR-716"
 /db_xref="taxon:10548"
 gene complement(<1..1557)
 /gene="E2A"
 CDS complement(1..1557)
 /gene="E2A"
  /codon_start=1
 /product="DNA binding protein"
 /protein_id="AAW33487.1"
 /db_xref="GI:57115680"
  /translation="MASREGNQLSDRHREHTPERGRGSASHPPSRSDRSPSQSPPPLP
 PKRNTCRRVGSGSSTDSQLVMVSETSQSSLSPERSDSPPPPIPPKKKPRKTKHVPMQD
 ISQDSEEEREEAQLVAVGFSYPPVRIVEKDGKRSIEKIAKDDPLAKGAAACTVKNPIS
 LPLVSAWEKGMEVMCLLMEKYRLDNELRTSFKLMPEQHEQYKRICHQYVNEEHRGIQL
 TFTSHKTLSTMMGRFLQGMIHSFSQIAHHNWECTGCALWPHGCNDYEGKLKCLHGNIM
 IQKEQIIEMDVASENGQRALKENPERTKITQNRWGRSVVQIANNDARCCVNDAGCAAN
 QFSSRSCGMFYTEGSKAQQAFKQYDAFMRAVYPGIRQDQAKMILIPLHCDCNHKPNWV
 PAMGRQTCKMTPFSIANAEDLDVGMIADPTVLASVRHPSLMVFQCCNPVYRNSRAQST
 GPNCDFKISAPDLLGALQLTRKLWSDILPDIPVPKLVIPEFKWQPKYQFRNVSLPAGH
 SDSRQNPFDL"
ORIGIN 
 1 ttacaagtcg aatgggttct gacgagaatc agaatgaccc gcaggcagtg atacgttgcg
 61 gaactgatac ttgggttgcc acttgaattc gggaatcacc aacttgggaa ccggtatatc
 121 gggcaggatg tcactccaca gctttctggt cagctgcaaa gctcccagca ggtcaggagc
 181 cgaaatcttg aaatcacaat taggaccagt gctctgagcg cgagagttgc ggtacaccgg
 241 attgcagcac tgaaacacca tcagcgacgg atgtcttacg cttgccagca cggtgggatc
 301 tgcaatcatg cccacatcca gatcttcagc attggcaatg ctgaacgggg tcatcttgca
 361 ggtctgccta cccatggcgg gcacccaatt aggcttgtgg ttacaatcgc agtgcagggg
 421 gatcagtatc atcttggcct gatcctgtct gattcctgga tacacggctc tcatgaaagc
 481 atcatattgc ttgaaagcct gctgggcttt actaccctcg gtataaaaca tcccgcagga
 541 cctgctcgaa aactggttag ctgcgcagcc ggcatcattc acacagcagc gggcgtcatt
 601 gttggctatt tgcaccacac ttctgcccca gcggttttgg gtgattttgg ttcgctcggg
 661 attctccttc aaggctcgtt gtccgttctc gctggccaca tccatctcga taatctgctc
 721 cttctgaatc ataatattgc catgcaagca cttcagcttg ccctcataat cattgcagcc
 781 atgaggccac aacgcacagc ctgtacattc ccaattatgg tgggcgatct gagaaaaaga
 841 atgtatcatt ccctgcagaa atcttcccat catcgtgctc agtgtcttgt gactagtgaa
 901 agttaactgg atgcctcggt gctcctcgtt cacgtactgg tgacagatgc gcttgtattg
 961 ttcgtgctgc tcaggcatta gtttaaaaga ggttctaagt tcgttatcca gcctgtactt
 1021 ctccatcagc agacacatca cttccatgcc tttctcccaa gcagacacca ggggcaagct
 1081 aatcggattc ttaacagtgc aggcagcagc tcctttagcc agagggtcat ctttggcgat
 1141 cttctcaatg cttcttttgc catccttctc aacgatgcgc acgggcgggt agctgaaacc
 1201 cactgctaca agttgcgcct cttctctttc ttcttcgctg tcttgactga tgtcttgcat
 1261 ggggacatgt ttggtcttcc ttggcttctt tttcgggggt atcggaggag gaggactgtc
 1321 gctccgttcc ggagacaggg aggattgtga cgtttcgctc accattacca actgactgtc
 1381 ggtagaagaa cctgacccca cacggcgaca ggtgtttctc ttcgggggca gaggtggagg
 1441 cgattgcgaa gggctgcggt ccgacctgga aggcggatga ctggcagaac cccttccgcg
 1501 ttcgggggtg tgctccctgt ggcggtcgct taactgattt ccttcgcggc tggccat
//