LOCUS AY737797 420 bp DNA linear VRL 27-DEC-2005
DEFINITION Human adenovirus type 34 strain Compton, complete genome.
ACCESSION AY737797 REGION: 3483..3902
VERSION AY737797.1 GI:57115661
KEYWORDS .
SOURCE Human adenovirus 34
 ORGANISM Human adenovirus 34
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 420)
 AUTHORS Tibbetts,C., Purkayastha,A., Clark,J., Carlisle,S., Rowley,R.,
 Hanson,E. and Seto,D.
 CONSRTM Epidemic Outbreak Surveillance (EOS)
 TITLE The complete nucleotide sequence and genome organization of Human
 Adenovirus Serotype 34
 JOURNAL Unpublished
REFERENCE 2 (bases 1 to 420)
 AUTHORS Tibbetts,C., Purkayastha,A., Clark,J., Carlisle,S., Reynolds,T.,
 Rowley,R., Hanson,E. and Seto,D.
 CONSRTM Epidemic Outbreak Surveillance (EOS)
 TITLE Direct Submission
 JOURNAL Submitted (30-AUG-2004) Modernization Directorate (SGR), USAF
 Surgeon General Office HQ, 5201 Leesburg Pike, Suite 1401, Falls
 Church, VA 22041, USA
FEATURES Location/Qualifiers
 source 1..420
 /organism="Human adenovirus 34"
 /mol_type="genomic DNA"
 /strain="Compton; ATCC VR-716"
 /serotype="34"
 /db_xref="ATCC:VR-716"
 /db_xref="taxon:10548"
 gene 1..>420
 /gene="IX"
 CDS 1..420
 /gene="IX"
 /codon_start=1
 /product="hexon associated protein IX"
 /protein_id="AAW33474.1"
 /db_xref="GI:57115667"
 /translation="MSGNASFKGGVFSPYLTGRLPSWAGVRQNVMGSTVDGRPVQPAN
 SSTLTYATLSSSPLDAAAAAAAASVAANTVLGMGYYGSIVANSTSSNNPSTLTQDKLL
 VLLAQLEALTQRLGELYQQVAELRVQTESAVGTAKSK"
ORIGIN 
 1 atgagtggaa acgcttcttt taagggggga gtcttcagcc cttatctgac agggcgtctc
 61 ccatcctggg caggagttcg tcagaatgtt atgggatcta ctgtggatgg aagacccgtc
  121 caacccgcca attcttcaac gctgacctat gctactttaa gttcttcacc tttggacgca
 181 gctgcagccg ccgccgccgc ctctgttgcc gctaacactg tgcttggaat gggttactat
 241 ggaagtatcg tggctaattc cacttcctct aataaccctt ctaccctgac tcaggacaag
 301 ttacttgtcc ttttggccca gctggaggct ttgacccaac gtctgggtga actttatcag
 361 caggtggccg agttgcgagt acaaactgag tctgctgtcg gcacggcaaa gtctaaataa
//