LOCUS       AY737797                 579 bp    DNA     linear   VRL 27-DEC-2005
DEFINITION  Human adenovirus type 34 strain Compton, complete genome.
ACCESSION   AY737797 REGION: 15371..15949
VERSION     AY737797.1  GI:57115661
KEYWORDS    .
SOURCE      Human adenovirus 34
  ORGANISM  Human adenovirus 34
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE   1  (bases 1 to 579)
  AUTHORS   Tibbetts,C., Purkayastha,A., Clark,J., Carlisle,S., Rowley,R.,
            Hanson,E. and Seto,D.
  CONSRTM   Epidemic Outbreak Surveillance (EOS)
  TITLE     The complete nucleotide sequence and genome organization of Human
            Adenovirus Serotype 34
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 579)
  AUTHORS   Tibbetts,C., Purkayastha,A., Clark,J., Carlisle,S., Reynolds,T.,
            Rowley,R., Hanson,E. and Seto,D.
  CONSRTM   Epidemic Outbreak Surveillance (EOS)
  TITLE     Direct Submission
  JOURNAL   Submitted (30-AUG-2004) Modernization Directorate (SGR), USAF
            Surgeon General Office HQ, 5201 Leesburg Pike, Suite 1401, Falls
            Church, VA 22041, USA
FEATURES             Location/Qualifiers
     source          1..579
                     /organism="Human adenovirus 34"
                     /mol_type="genomic DNA"
                     /strain="Compton; ATCC VR-716"
                     /serotype="34"
                     /db_xref="ATCC:VR-716"
                     /db_xref="taxon:10548"
     gene            <1..>579
                     /gene="L2"
     CDS             1..579
                     /gene="L2"
                     /codon_start=1
                     /product="protein VII precursor"
                     /protein_id="AAW33482.1"
                     /db_xref="GI:57115675"
                     /translation="MSVLISPSNNTGWGLRAPSKMYGGARKRSTQHPVRVRGHFRAPW
                     GALKGRTRVRTTVDDVIDQVVADARNYTPTAPTSTVDAVIDSVVADARNYARRKSRRR
                     RIARRHRATTAMRAARALLRRARRVGRRAMLRAARRAASGASAGRSRRQAAAVAAATI
                     ADMAQSRRGNVYWVRDAATGQRVPVRTRPPRT"
ORIGIN      
        1 atgtccgttc ttatctcgcc cagtaataac accggttggg gtctgcgcgc tcccagcaag
       61 atgtacggag gcgcacgcaa acgttctacc caacatcccg tgcgtgttcg cgggcatttt
      121 cgcgctccat ggggtgccct caagggccgc actcgcgttc gaaccaccgt cgatgatgta
      181 atcgatcagg tggttgccga cgcccgtaat tatactccta ctgcgcctac atctactgtg
      241 gacgcagtta ttgacagtgt agtggctgac gctcgcaact atgctcgacg taagagccgg
      301 cgaaggcgca ttgccagacg tcaccgagct accactgcca tgcgagcagc aagagctctg
      361 ctacgaagag ctagacgcgt ggggcgaaga gccatgctta gggcggccag acgtgcagct
      421 tcgggcgcca gcgccggcag gtcccgcagg caagcagccg ctgtcgcagc ggcgactatt
      481 gccgacatgg cccaatcgcg aagaggcaat gtatactggg tgcgtgacgc tgccaccggt
      541 caacgtgtac ccgtgcgcac ccgtccccct cgcacttag
//