LOCUS       AY128640                 789 bp    DNA     linear   VRL 12-DEC-2003
DEFINITION  Human adenovirus type 35 strain Holden, complete genome.
ACCESSION   AY128640 REGION: join(569..1148,1233..1441)
VERSION     AY128640.2  GI:38196041
KEYWORDS    .
SOURCE      Human adenovirus 35
  ORGANISM  Human adenovirus 35
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE   1  (bases 1 to 789)
  AUTHORS   Gao,W., Robbins,P.D. and Gambotto,A.
  TITLE     Human adenovirus type 35: nucleotide sequence and vector
            development
  JOURNAL   Gene Ther. 10 (23), 1941-1949 (2003)
   PUBMED   14528318
REFERENCE   2  (bases 1 to 789)
  AUTHORS   Gao,W., Robbins,P.D. and Gambotto,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-JUL-2002) Surgery, University of Pittsburgh, 300
            Technology Drive, Pittsburgh, PA 15219, USA
REFERENCE   3  (bases 1 to 789)
  AUTHORS   Gao,W., Robbins,P.D. and Gambotto,A.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-NOV-2003) Surgery, University of Pittsburgh, 300
            Technology Drive, Pittsburgh, PA 15219, USA
  REMARK    Sequence update by submitter
COMMENT     On Nov 6, 2003 this sequence version replaced gi:35670771.
FEATURES             Location/Qualifiers
     source          1..789
                     /organism="Human adenovirus 35"
                     /mol_type="genomic DNA"
                     /strain="ATCC VR-718; Holden"
                     /db_xref="ATCC:VR-718"
                     /db_xref="taxon:10522"
     CDS             1..789
                     /note="transcription activation; early protein"
                     /codon_start=1
                     /product="E1a 261R protein"
                     /protein_id="AAN17469.1"
                     /db_xref="GI:35670772"
                     /translation="MRDLRFLPQEIISAETGNEILELVVHALMGDDPEPPVQLFEPPT
                     LQELYDLEVEGSEDSNEEAVNGFFTDSMLLAANEGLELDPPLDTFNTPGVIVESGTGV
                     RKLPDLSSVDCDLHCYEDGFPPSDEEDHEKEQSMQTAAGEGVKAANVGFQLDCPELPG
                     HGCKSCEFHRKNTGVKELLCSLCYMRTHCHFIYSPVSDADESPSPDSTTSPPDIQAPV
                     PVDVRKPIPVKLKPGKRPAVEKLEDLLQGGDGPLDLSTRKRPRQ"
     CDS             join(1..487,581..789)
                     /note="transcription activation; early protein;
                     alternatively spliced"
                     /codon_start=1
                     /product="E1a 230R protein"
                     /protein_id="AAN17470.1"
                     /db_xref="GI:35670773"
                     /translation="MRDLRFLPQEIISAETGNEILELVVHALMGDDPEPPVQLFEPPT
                     LQELYDLEVEGSEDSNEEAVNGFFTDSMLLAANEGLELDPPLDTFNTPGVIVESGTGV
                     RKLPDLSSVDCDLHCYEDGFPPSDEEDHEKEQSMQTAAGEGVKAANVGFQLDCPELPG
                     HGCPVSDADESPSPDSTTSPPDIQAPVPVDVRKPIPVKLKPGKRPAVEKLEDLLQGGD
                     GPLDLSTRKRPRQ"
     CDS             join(1..72,581..685)
                     /note="transcription activation; early protein;
                     alternatively spliced"
                     /codon_start=1
                     /product="E1a 58R protein"
                     /protein_id="AAN17471.1"
                     /db_xref="GI:35670774"
                     /translation="MRDLRFLPQEIISAETGNEILELVVLCLMLMNHHLLILLPHLLI
                     FKHLFLWTCASPFL"
ORIGIN      
        1 atgagagatt tgcgatttct gcctcaggaa ataatctctg ctgagactgg aaatgaaata
       61 ttggagcttg tggtgcacgc cctgatggga gacgatccgg agccacctgt gcagcttttt
      121 gagcctccta cgcttcagga actgtatgat ttagaggtag agggatcgga ggattctaat
      181 gaggaagctg tgaatggctt ttttaccgat tctatgcttt tagctgctaa tgaaggatta
      241 gaattagatc cgcctttgga cactttcaat actccagggg tgattgtgga aagcggtaca
      301 ggtgtaagaa aattacctga tttgagttcc gtggactgtg atttgcactg ctatgaagac
      361 gggtttcctc cgagtgatga ggaggaccat gaaaaggagc agtccatgca gactgcagcg
      421 ggtgagggag tgaaggctgc caatgttggt tttcagttgg attgcccgga gcttcctgga
      481 catggctgta agtcttgtga atttcacagg aaaaatactg gagtaaagga actgttatgt
      541 tcgctttgtt atatgagaac gcactgccac tttatttaca gtcctgtgtc tgatgctgat
      601 gaatcaccat ctcctgattc tactacctca cctcctgata ttcaagcacc tgttcctgtg
      661 gacgtgcgca agcccattcc tgtgaagctt aagcctggga aacgtccagc agtggagaaa
      721 cttgaggact tgttacaggg tggggacgga cctttggact tgagtacacg gaaacgtcca
      781 agacaataa
//