LOCUS AY128640 630 bp DNA linear VRL 12-DEC-2003
DEFINITION Human adenovirus type 35 strain Holden, complete genome.
ACCESSION AY128640 REGION: 21150..21779
VERSION AY128640.2 GI:38196041
KEYWORDS .
SOURCE Human adenovirus 35
 ORGANISM Human adenovirus 35
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 630)
 AUTHORS Gao,W., Robbins,P.D. and Gambotto,A.
 TITLE Human adenovirus type 35: nucleotide sequence and vector
  development
 JOURNAL Gene Ther. 10 (23), 1941-1949 (2003)
 PUBMED 14528318
REFERENCE 2 (bases 1 to 630)
 AUTHORS Gao,W., Robbins,P.D. and Gambotto,A.
 TITLE Direct Submission
 JOURNAL Submitted (03-JUL-2002) Surgery, University of Pittsburgh, 300
 Technology Drive, Pittsburgh, PA 15219, USA
REFERENCE 3 (bases 1 to 630)
 AUTHORS Gao,W., Robbins,P.D. and Gambotto,A.
 TITLE Direct Submission
 JOURNAL Submitted (06-NOV-2003) Surgery, University of Pittsburgh, 300
 Technology Drive, Pittsburgh, PA 15219, USA
 REMARK Sequence update by submitter
COMMENT On Nov 6, 2003 this sequence version replaced gi:35670771.
FEATURES Location/Qualifiers
 source 1..630
 /organism="Human adenovirus 35"
 /mol_type="genomic DNA"
 /strain="ATCC VR-718; Holden"
 /db_xref="ATCC:VR-718"
 /db_xref="taxon:10522"
 CDS 1..630
 /note="virus encoded endoprotease"
 /codon_start=1
 /product="23K protein"
 /protein_id="AAN17485.1"
 /db_xref="GI:35670788"
 /translation="MACGSQNGSSEQELRAIVQDLGCGPYFLGTYDKRFPGFMAPDKL
 ACAIVNTAGRETGGEHWLAFGWNPRSNTCYLFDPFGFSDDRLKQIYQFEYEGLLRRSA
 LATKDRCITLEKSTQTVQGPRSAACGLFCCMFLHAFVHWPDRPMDGNPTMKLLTGVPN
 NMLHSPKVQPTLCDNQKALYHFLNTHSPYFRSHRTHIERATAFDRMDVQ"
ORIGIN 
 1 atggcctgcg gatcccaaaa cggctccagc gagcaagagc tcagagccat tgtccaagac
 61 ctgggttgcg gaccctattt tttgggaacc tacgataagc gcttcccggg gttcatggcc
 121 cccgataagc tcgcctgtgc cattgtaaat acggccggac gtgagacggg gggagagcac
 181 tggttggctt tcggttggaa cccacgttct aacacctgct acctttttga tccttttgga
  241 ttctcggatg atcgtctcaa acagatttac cagtttgaat atgagggtct cctgcgccgc
 301 agcgctcttg ctaccaagga ccgctgtatt acgctggaaa aatctaccca gaccgtgcag
 361 ggcccccgtt ctgccgcctg cggacttttc tgctgcatgt tccttcacgc ctttgtgcac
 421 tggcctgacc gtcccatgga cggaaacccc accatgaaat tgctaactgg agtgccaaac
 481 aacatgcttc attctcctaa agtccagccc accctgtgtg acaatcaaaa agcactctac
 541 cattttctta atacccattc gccttatttt cgctctcatc gtacacacat cgaaagggcc
 601 actgcgttcg accgtatgga tgttcaataa
//