LOCUS AY128640 696 bp DNA linear VRL 12-DEC-2003
DEFINITION Human adenovirus type 35 strain Holden, complete genome.
ACCESSION AY128640 REGION: join(569..1055,1233..1441)
VERSION AY128640.2 GI:38196041
KEYWORDS .
SOURCE Human adenovirus 35
ORGANISM Human adenovirus 35
Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 696)
AUTHORS Gao,W., Robbins,P.D. and Gambotto,A.
TITLE Human adenovirus type 35: nucleotide sequence and vector
development
JOURNAL Gene Ther. 10 (23), 1941-1949 (2003)
PUBMED 14528318
REFERENCE 2 (bases 1 to 696)
AUTHORS Gao,W., Robbins,P.D. and Gambotto,A.
TITLE Direct Submission
JOURNAL Submitted (03-JUL-2002) Surgery, University of Pittsburgh, 300
Technology Drive, Pittsburgh, PA 15219, USA
REFERENCE 3 (bases 1 to 696)
AUTHORS Gao,W., Robbins,P.D. and Gambotto,A.
TITLE Direct Submission
JOURNAL Submitted (06-NOV-2003) Surgery, University of Pittsburgh, 300
Technology Drive, Pittsburgh, PA 15219, USA
REMARK Sequence update by submitter
COMMENT On Nov 6, 2003 this sequence version replaced gi:35670771.
FEATURES Location/Qualifiers
source 1..696
/organism="Human adenovirus 35"
/mol_type="genomic DNA"
/strain="ATCC VR-718; Holden"
/db_xref="ATCC:VR-718"
/db_xref="taxon:10522"
CDS 1..696
/note="transcription activation; early protein"
/codon_start=1
/product="E1a 261R protein"
/protein_id="AAN17469.1"
/db_xref="GI:35670772"
/translation="MRDLRFLPQEIISAETGNEILELVVHALMGDDPEPPVQLFEPPT
LQELYDLEVEGSEDSNEEAVNGFFTDSMLLAANEGLELDPPLDTFNTPGVIVESGTGV
RKLPDLSSVDCDLHCYEDGFPPSDEEDHEKEQSMQTAAGEGVKAANVGFQLDCPELPG
HGCKSCEFHRKNTGVKELLCSLCYMRTHCHFIYSPVSDADESPSPDSTTSPPDIQAPV
PVDVRKPIPVKLKPGKRPAVEKLEDLLQGGDGPLDLSTRKRPRQ"
CDS 1..696
/note="transcription activation; early protein;
alternatively spliced"
/codon_start=1
/product="E1a 230R protein"
/protein_id="AAN17470.1"
/db_xref="GI:35670773"
/translation="MRDLRFLPQEIISAETGNEILELVVHALMGDDPEPPVQLFEPPT
LQELYDLEVEGSEDSNEEAVNGFFTDSMLLAANEGLELDPPLDTFNTPGVIVESGTGV
RKLPDLSSVDCDLHCYEDGFPPSDEEDHEKEQSMQTAAGEGVKAANVGFQLDCPELPG
HGCPVSDADESPSPDSTTSPPDIQAPVPVDVRKPIPVKLKPGKRPAVEKLEDLLQGGD
GPLDLSTRKRPRQ"
CDS join(1..72,488..592)
/note="transcription activation; early protein;
alternatively spliced"
/codon_start=1
/product="E1a 58R protein"
/protein_id="AAN17471.1"
/db_xref="GI:35670774"
/translation="MRDLRFLPQEIISAETGNEILELVVLCLMLMNHHLLILLPHLLI
FKHLFLWTCASPFL"
ORIGIN
1 atgagagatt tgcgatttct gcctcaggaa ataatctctg ctgagactgg aaatgaaata
61 ttggagcttg tggtgcacgc cctgatggga gacgatccgg agccacctgt gcagcttttt
121 gagcctccta cgcttcagga actgtatgat ttagaggtag agggatcgga ggattctaat
181 gaggaagctg tgaatggctt ttttaccgat tctatgcttt tagctgctaa tgaaggatta
241 gaattagatc cgcctttgga cactttcaat actccagggg tgattgtgga aagcggtaca
301 ggtgtaagaa aattacctga tttgagttcc gtggactgtg atttgcactg ctatgaagac
361 gggtttcctc cgagtgatga ggaggaccat gaaaaggagc agtccatgca gactgcagcg
421 ggtgagggag tgaaggctgc caatgttggt tttcagttgg attgcccgga gcttcctgga
481 catggctgtc ctgtgtctga tgctgatgaa tcaccatctc ctgattctac tacctcacct
541 cctgatattc aagcacctgt tcctgtggac gtgcgcaagc ccattcctgt gaagcttaag
601 cctgggaaac gtccagcagt ggagaaactt gaggacttgt tacagggtgg ggacggacct
661 ttggacttga gtacacggaa acgtccaaga caataa
//