LOCUS AY128640 420 bp DNA linear VRL 12-DEC-2003
DEFINITION Human adenovirus type 35 strain Holden, complete genome.
ACCESSION AY128640 REGION: 3484..3903
VERSION AY128640.2 GI:38196041
KEYWORDS .
SOURCE Human adenovirus 35
 ORGANISM Human adenovirus 35
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 420)
 AUTHORS Gao,W., Robbins,P.D. and Gambotto,A.
 TITLE Human adenovirus type 35: nucleotide sequence and vector
 development
 JOURNAL Gene Ther. 10 (23), 1941-1949 (2003)
 PUBMED 14528318
REFERENCE 2 (bases 1 to 420)
 AUTHORS Gao,W., Robbins,P.D. and Gambotto,A.
 TITLE Direct Submission
 JOURNAL Submitted (03-JUL-2002) Surgery, University of Pittsburgh, 300
 Technology Drive, Pittsburgh, PA 15219, USA
REFERENCE 3 (bases 1 to 420)
 AUTHORS Gao,W., Robbins,P.D. and Gambotto,A.
 TITLE Direct Submission
 JOURNAL Submitted (06-NOV-2003) Surgery, University of Pittsburgh, 300
 Technology Drive, Pittsburgh, PA 15219, USA
 REMARK Sequence update by submitter
COMMENT On Nov 6, 2003 this sequence version replaced gi:35670771.
FEATURES Location/Qualifiers
 source 1..420
 /organism="Human adenovirus 35"
  /mol_type="genomic DNA"
 /strain="ATCC VR-718; Holden"
 /db_xref="ATCC:VR-718"
 /db_xref="taxon:10522"
 CDS 1..420
 /note="hexon associated protein"
 /codon_start=1
 /product="pIX"
  /protein_id="AAN17474.1"
 /db_xref="GI:35670777"
 /translation="MSGNASFKGGVFSPYLTGRLPSWAGVRQNVMGSTVDGRPVQPAN
 SSTLTYATLSSSPLDAAAAAAAASVAANTVLGMGYYGSIVANSTSSNNPSTLTQDKLL
 VLLAQLEALTQRLGELSQQVAELRVQTESAVGTAKSK"
ORIGIN 
 1 atgagtggaa atgcttcttt taagggggga gtcttcagcc cttatctgac agggcgtctc
 61 ccatcctggg caggagttcg tcagaatgtt atgggatcta ctgtggatgg aagacccgtt
 121 caacccgcca attcttcaac gctgacctat gctactttaa gttcttcacc tttggacgca
 181 gctgcagccg ctgccgccgc ctctgtcgcc gctaacactg tgcttggaat gggttactat
 241 ggaagcatcg tggctaattc cacttcctct aataaccctt ctacactgac tcaggacaag
  301 ttacttgtcc ttttggccca gctggaggct ttgacccaac gtctgggtga actttctcag
 361 caggtggccg agttgcgagt acaaactgag tctgctgtcg gcacggcaaa gtctaaataa
//