LOCUS AY128640 1056 bp DNA linear VRL 12-DEC-2003
DEFINITION Human adenovirus type 35 strain Holden, complete genome.
ACCESSION AY128640 REGION: 16004..17059
VERSION AY128640.2 GI:38196041
KEYWORDS .
SOURCE Human adenovirus 35
 ORGANISM Human adenovirus 35
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 1056)
 AUTHORS Gao,W., Robbins,P.D. and Gambotto,A.
 TITLE Human adenovirus type 35: nucleotide sequence and vector
 development
 JOURNAL Gene Ther. 10 (23), 1941-1949 (2003)
 PUBMED 14528318
REFERENCE 2 (bases 1 to 1056)
 AUTHORS Gao,W., Robbins,P.D. and Gambotto,A.
 TITLE Direct Submission
 JOURNAL Submitted (03-JUL-2002) Surgery, University of Pittsburgh, 300
 Technology Drive, Pittsburgh, PA 15219, USA
REFERENCE 3 (bases 1 to 1056)
 AUTHORS Gao,W., Robbins,P.D. and Gambotto,A.
 TITLE Direct Submission
 JOURNAL Submitted (06-NOV-2003) Surgery, University of Pittsburgh, 300
 Technology Drive, Pittsburgh, PA 15219, USA
 REMARK Sequence update by submitter
COMMENT On Nov 6, 2003 this sequence version replaced gi:35670771.
FEATURES Location/Qualifiers
 source 1..1056
 /organism="Human adenovirus 35"
 /mol_type="genomic DNA"
  /strain="ATCC VR-718; Holden"
 /db_xref="ATCC:VR-718"
 /db_xref="taxon:10522"
 CDS 1..1056
 /note="minor core protein"
 /codon_start=1
 /product="pV"
 /protein_id="AAN17483.1"
 /db_xref="GI:35670786"
 /translation="MSKRKYKEEMLQVIAPEVYGQPLKDEKKPRKIKRVKKDKKEEED
 GDDGLAEFVREFAPRRRVQWRGRKVRHVLRPGTSVVFTPGERSSATFKRSYDEVYGDD
 DILEQAADRLGEFAYGKRSRITSKDETVSIPLDHGNPTPSLKPVTLQQVLPVTPRTGV
 KREGEDLYPTMQLMVPKRQKLEDVLEKVKVDPDIQPEVKVRPIKQVAPGLGVQTVDIK
 IPTESMEVQTEPAKPTATSTEVQTDPWMPMPITTDAAGPTRRSRRKYGPASLLMPNYV
 VHPSIIPTPGYRGTRYYRSRNSTSRRRRKTPANRSRRRRRTSKPTPGALVRQVYRNGS
 AEPLTLPRARYHPSIIT"
ORIGIN 
 1 atgtccaagc gcaaatacaa ggaagaaatg ctgcaggtta tcgcacctga agtctacggc
 61 caaccgttga aggatgaaaa aaaaccccgc aaaatcaagc gggttaaaaa ggacaaaaaa
 121 gaagaggaag atggcgatga tgggctggcg gagtttgtgc gcgagtttgc cccacggcga
 181 cgcgtgcaat ggcgtgggcg caaagttcga catgtgttga gacctggaac ttcggtggtc
 241 tttacacccg gcgagcgttc aagcgctact tttaagcgtt cctatgatga ggtgtacggg
 301 gatgatgata ttcttgagca ggcggctgac cgattaggcg agtttgctta tggcaagcgt
 361 agtagaataa cttccaagga tgagacagtg tcaataccct tggatcatgg aaatcccacc
 421 cctagtctta aaccggtcac tttgcagcaa gtgttacccg taactccgcg aacaggtgtt
  481 aaacgcgaag gtgaagattt gtatcccact atgcaactga tggtacccaa acgccagaag
 541 ttggaggacg ttttggagaa agtaaaagtg gatccagata ttcaacctga ggttaaagtg
 601 agacccatta agcaggtagc gcctggtctg ggggtacaaa ctgtagacat taagattccc
 661 actgaaagta tggaagtgca aactgaaccc gcaaagccta ctgccacctc cactgaagtg
 721 caaacggatc catggatgcc catgcctatt acaactgacg ccgccggtcc cactcgaaga
 781 tcccgacgaa agtacggtcc agcaagtctg ttgatgccca attatgttgt acacccatct
 841 attattccta ctcctggtta ccgaggcact cgctactatc gcagccgaaa cagtacctcc
 901 cgccgtcgcc gcaagacacc tgcaaatcgc agtcgtcgcc gtagacgcac aagcaaaccg
 961 actcccggcg ccctggtgcg gcaagtgtac cgcaatggta gtgcggaacc tttgacactg
 1021 ccgcgtgcgc gttaccatcc gagtatcatc acttaa
//