LOCUS AY128640 510 bp DNA linear VRL 12-DEC-2003
DEFINITION Human adenovirus type 35 strain Holden, complete genome.
ACCESSION AY128640 REGION: 33100..33609
VERSION AY128640.2 GI:38196041
KEYWORDS .
SOURCE Human adenovirus 35
 ORGANISM Human adenovirus 35
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 510)
 AUTHORS Gao,W., Robbins,P.D. and Gambotto,A.
 TITLE Human adenovirus type 35: nucleotide sequence and vector
 development
 JOURNAL Gene Ther. 10 (23), 1941-1949 (2003)
 PUBMED 14528318
REFERENCE 2 (bases 1 to 510)
 AUTHORS Gao,W., Robbins,P.D. and Gambotto,A.
 TITLE Direct Submission
 JOURNAL Submitted (03-JUL-2002) Surgery, University of Pittsburgh, 300
 Technology Drive, Pittsburgh, PA 15219, USA
REFERENCE 3 (bases 1 to 510)
 AUTHORS Gao,W., Robbins,P.D. and Gambotto,A.
 TITLE Direct Submission
 JOURNAL Submitted (06-NOV-2003) Surgery, University of Pittsburgh, 300
 Technology Drive, Pittsburgh, PA 15219, USA
 REMARK Sequence update by submitter
COMMENT On Nov 6, 2003 this sequence version replaced gi:35670771.
FEATURES Location/Qualifiers
 source 1..510
 /organism="Human adenovirus 35"
 /mol_type="genomic DNA"
 /strain="ATCC VR-718; Holden"
 /db_xref="ATCC:VR-718"
 /db_xref="taxon:10522"
 CDS complement(<1..146)
 /codon_start=1
 /product="E4 122R protein"
 /protein_id="AAN17497.1"
 /db_xref="GI:35670800"
 /translation="MVLPSLPSPLLLETQSSCIAWLGFAYATVDDFLRTIRCDGVLIT
 TEASILLTNLRVWLYLNYHTEHAKRQDRRRRRVCSARAAFCYTKYENVRKQLHYDKVA
 RTLDIMRQTSPLHQSPVTTL"
 misc_RNA 1..510
 /note="VA RNA region"
 CDS complement(155..508)
 /codon_start=1
  /product="E4 117R protein"
 /protein_id="AAN17496.1"
 /db_xref="GI:35670799"
 /translation="MRVCLRMVVEGALRDLFVMCGLDLPQELTRIIQGWKAENYLGMV
 QECNMMIEELENAPSFGILLFLDVRVEALLEATVEHLENRISFDLAVLFHQHSGGERC
 HLRDLQFEVLRDRLE"
 CDS complement(505..>510)
 /codon_start=1
 /product="E4 145R protein"
 /protein_id="AAN17499.1"
 /db_xref="GI:35670802"
 /translation="MTLVFFLFLQTNSKLTMLERSAVTYCICIPEVLNVFLANFSFIQ
 FLQETLPDYISSNFDDITGGSQYAYSNLVFAGANWGGLRLYCTVASPALVPGGLLAKQ
 FGDNMREFLQLELKEELRAKGMSIDVAILNSLQVTQEQDILSL"
ORIGIN 
 1 atgctggctt cagttgtaat caaaactcca tcgcatctaa ttgttctgag gaaatcatcc
 61 acggtagcat atgcaaatcc caaccaagca atgcaactgg attgcgtttc aagcaggaga
 121 ggagagggaa gagacggaag aaccatgtta atttttattc caaacgatct cgcagtactt
 181 caaattgtag atcgcgcaga tggcatctct cgcccccact gtgttggtga aaaagcacag
 241 ctaaatcaaa agaaatgcga ttttcaaggt gctcaacggt ggcttccaac aaagcctcca
 301 cgcgcacatc caagaacaaa agaataccaa aagaaggagc attttctaac tcctcaatca
 361 tcatattaca ttcctgcacc attcccagat aattttcagc tttccagcct tgaattattc
 421 gtgtcagttc ttgtggtaaa tccaatccac acattacaaa caggtcccgg agggcgccct
 481 ccaccaccat tcttaaacac accctcataa
//