LOCUS AY737798 630 bp DNA linear VRL 30-AUG-2005
DEFINITION Human adenovirus type 50 strain Wan, complete genome.
ACCESSION AY737798 REGION: 21319..21948
VERSION AY737798.1 GI:57115702
KEYWORDS .
SOURCE Human adenovirus 50
 ORGANISM Human adenovirus 50
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 630)
 AUTHORS Tibbetts,C., Purkayastha,A., Clark,J., Helber,S., Rowley,R.,
 Hanson,E. and Seto,D.
 CONSRTM Epidemic Outbreak Surveillance (EOS)
 TITLE The complete nucleotide sequence and genome organization of Human
 Adenovirus Serotype 50
 JOURNAL Unpublished
REFERENCE 2 (bases 1 to 630)
 AUTHORS Tibbetts,C., Purkayastha,A., Clark,J., Helber,S., Rowley,R.,
 Hanson,E. and Seto,D.
 CONSRTM Epidemic Outbreak Surveillance (EOS)
 TITLE Direct Submission
 JOURNAL Submitted (30-AUG-2004) Modernization Directorate (SGR), USAF
 Surgeon General Office HQ, 5201 Leesburg Pike, Suite 1401, Falls
 Church, VA 22041, USA
FEATURES Location/Qualifiers
 source 1..630
 /organism="Human adenovirus 50"
 /mol_type="genomic DNA"
 /strain="Wan; ATCC VR-1502"
 /serotype="50"
 /db_xref="ATCC:VR-1502"
 /db_xref="taxon:107462"
 gene <1..>630
 /gene="L3"
 CDS 1..630
 /gene="L3"
 /codon_start=1
  /product="23 kDa protein"
 /protein_id="AAW33531.1"
 /db_xref="GI:57115725"
 /translation="MSCGSGNGSSEQELKAIVRDLGCGPYFLGTFDKRFPGFMAPDKL
 ACAIVNTAGRETGGEHWLAFGWNPRSNTCYLFDPFGFSDERLKQIYQFEYEGLLRRSA
 LATKDRCITLEKSTQSVQGPRSAACGLFCCMFLHAFVHWPDRPMNGNPTMKLLTGVSN
 SMLQSPQVQPTLRRNQEALYRFLNTHSSYFRSHRARIERATAFDRMDMQ"
ORIGIN 
 1 atgtcatgcg ggtccggaaa cggctccagc gagcaagagc tcaaagccat cgtccgagac
 61 ctgggctgcg gaccctattt cctgggaacc tttgacaagc gtttcccggg gttcatggcc
 121 cccgacaagc tcgcctgcgc catagtcaac actgccggac gcgagacggg gggagagcac
 181 tggctggctt ttggttggaa cccgcgctcc aacacctgct acctttttga tccttttggg
 241 ttctcggatg agcgactcaa acagatttac cagtttgagt acgaggggct cctgcgccgc
 301 agtgcccttg ctaccaaaga ccgctgcatc accctggaaa agtccaccca gagcgtgcag
 361 ggcccgcgct cagccgcctg tggacttttt tgctgtatgt tccttcatgc ctttgtgcac
 421 tggcccgacc gccccatgaa cggaaacccc accatgaagt tgctgactgg ggtgtcaaac
 481 agcatgctcc aatcacccca agtccagccc accctgcgcc gcaaccagga ggcgctatat
 541 cgcttcctaa acacccactc atcttacttt cgttctcacc gcgcacgcat tgaaagggcc
 601 accgcgtttg accgtatgga tatgcaataa
//