LOCUS AY737798 786 bp DNA linear VRL 30-AUG-2005
DEFINITION Human adenovirus type 50 strain Wan, complete genome.
ACCESSION AY737798 REGION: join(573..1152,1246..1451)
VERSION AY737798.1 GI:57115702
KEYWORDS .
SOURCE Human adenovirus 50
 ORGANISM Human adenovirus 50
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 786)
 AUTHORS Tibbetts,C., Purkayastha,A., Clark,J., Helber,S., Rowley,R.,
 Hanson,E. and Seto,D.
 CONSRTM Epidemic Outbreak Surveillance (EOS)
 TITLE The complete nucleotide sequence and genome organization of Human
 Adenovirus Serotype 50
 JOURNAL Unpublished
REFERENCE 2 (bases 1 to 786)
 AUTHORS Tibbetts,C., Purkayastha,A., Clark,J., Helber,S., Rowley,R.,
 Hanson,E. and Seto,D.
 CONSRTM Epidemic Outbreak Surveillance (EOS)
 TITLE Direct Submission
 JOURNAL Submitted (30-AUG-2004) Modernization Directorate (SGR), USAF
 Surgeon General Office HQ, 5201 Leesburg Pike, Suite 1401, Falls
 Church, VA 22041, USA
FEATURES Location/Qualifiers
 source 1..786
 /organism="Human adenovirus 50"
 /mol_type="genomic DNA"
 /strain="Wan; ATCC VR-1502"
 /serotype="50"
 /db_xref="ATCC:VR-1502"
 /db_xref="taxon:107462"
 gene <1..>786
 /gene="E1A"
 CDS 1..786
 /gene="E1A"
 /codon_start=1
 /product="29.1 kDa protein"
  /protein_id="AAW33510.1"
 /db_xref="GI:57115704"
 /translation="MRHLRFLPQEIISSETGIEILEFVVNTLMGDDPEPPAQPFDPPT
  LHDLYDLEVDGPDDPNEEAVNGFFTDSMLLAADEGLDINPPPETLDTPGVVVESGRGG
 IKLPDLGAAEMDLRCYEEGFPPSDDEDGETEQSIHTAVNEGVKAASDVFKLDCPELPG
 HGCKSCEFHRNNTGMKELLCSLCYMRMHCHFIYSPVSDDESPSPDSTTSPPEIQAPVP
 ANVCKPIPVKPKSGKRPAVDKLEDLLEGGDGPLDLSTRKLPRQ"
 CDS join(1..487,581..786)
 /gene="E1A"
 /codon_start=1
 /product="25.7 kDa protein"
 /protein_id="AAW33511.1"
 /db_xref="GI:57115705"
 /translation="MRHLRFLPQEIISSETGIEILEFVVNTLMGDDPEPPAQPFDPPT
 LHDLYDLEVDGPDDPNEEAVNGFFTDSMLLAADEGLDINPPPETLDTPGVVVESGRGG
 IKLPDLGAAEMDLRCYEEGFPPSDDEDGETEQSIHTAVNEGVKAASDVFKLDCPELPG
 HGCPVSDDESPSPDSTTSPPEIQAPVPANVCKPIPVKPKSGKRPAVDKLEDLLEGGDG
 PLDLSTRKLPRQ"
 CDS join(1..72,581..682)
  /gene="E1A"
 /codon_start=1
 /product="6.5 kDa protein"
 /protein_id="AAW33509.1"
 /db_xref="GI:57115703"
 /translation="MRHLRFLPQEIISSETGIEILEFVVLCLMMSRLLLIQLPHLLKF
 RRPYLQTYASPFL"
ORIGIN 
 1 atgagacacc tgcgattcct gccacaggag attatctcca gcgagaccgg gatagaaata
 61 ctggagtttg tggtaaatac cctgatggga gatgacccgg aaccgccagc gcagcctttc
 121 gatccaccta cgctgcacga tctgtatgat ttagaggtag acgggccgga cgatcccaat
 181 gaggaagctg taaatgggtt ttttactgat tctatgctac tagctgccga tgaaggattg
 241 gacataaacc ctcctcctga gacccttgat accccagggg tggttgtgga aagcggcaga
 301 ggtgggataa aattgcctga tctgggagca gctgaaatgg acttgcgttg ttatgaagag
 361 ggttttcctc cgagtgatga tgaagatggg gaaactgaac agtccatcca taccgcagtg
 421 aatgagggag taaaagctgc cagcgatgtt tttaagttgg actgtccgga gctgcctgga
 481 catggctgta agtcttgtga atttcacagg aataacactg gaatgaaaga actattgtgc
 541 tcgctttgct atatgagaat gcactgccat tttatttaca gtcctgtgtc tgatgatgag
 601 tcgccttctc ctgattcaac tacctcacct cctgaaattc aggcgcccgt acctgcaaac
 661 gtatgcaagc ccattcctgt gaagcctaag tctgggaaac gccctgctgt ggataagctt
 721 gaggacttgt tggagggtgg ggatggacct ttggacctta gtacccggaa actgccaagg
 781 caatga
//