LOCUS AY737798 417 bp DNA linear VRL 30-AUG-2005
DEFINITION Human adenovirus type 50 strain Wan, complete genome.
ACCESSION AY737798 REGION: 3476..3892
VERSION AY737798.1 GI:57115702
KEYWORDS .
SOURCE Human adenovirus 50
 ORGANISM Human adenovirus 50
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 417)
 AUTHORS Tibbetts,C., Purkayastha,A., Clark,J., Helber,S., Rowley,R.,
 Hanson,E. and Seto,D.
 CONSRTM Epidemic Outbreak Surveillance (EOS)
 TITLE The complete nucleotide sequence and genome organization of Human
 Adenovirus Serotype 50
 JOURNAL Unpublished
REFERENCE 2 (bases 1 to 417)
 AUTHORS Tibbetts,C., Purkayastha,A., Clark,J., Helber,S., Rowley,R.,
 Hanson,E. and Seto,D.
 CONSRTM Epidemic Outbreak Surveillance (EOS)
 TITLE Direct Submission
 JOURNAL Submitted (30-AUG-2004) Modernization Directorate (SGR), USAF
 Surgeon General Office HQ, 5201 Leesburg Pike, Suite 1401, Falls
 Church, VA 22041, USA
FEATURES Location/Qualifiers
 source 1..417
 /organism="Human adenovirus 50"
 /mol_type="genomic DNA"
 /strain="Wan; ATCC VR-1502"
 /serotype="50"
 /db_xref="ATCC:VR-1502"
 /db_xref="taxon:107462"
 gene <1..>417
 /gene="IX"
 CDS 1..417
 /gene="IX"
 /codon_start=1
 /product="hexon associated protein IX"
 /protein_id="AAW33514.1"
 /db_xref="GI:57115708"
 /translation="MSGSASFEGGVFSPYLTGRLPSWAGVRQNVMGSTVDGRPVQPAN
 SSTLTYATLSSSPLDAAAAAAATAAANTILGMGYYGSIVANSSSSNNPSTLAEDKLLV
 LLAQLEALTQRLGELSKQVAQLREQTESAVATAKSK"
ORIGIN 
 1 atgagtggaa gcgcttcttt tgagggggga gtatttagcc cttatctgac gggcaggctc
 61 ccatcatggg caggagttcg tcagaatgtc atgggatcca ctgtggatgg gagacccgtc
 121 cagcccgcca attcctcaac gctgacctat gccactttga gttcgtcacc attggatgca
 181 gctgcagccg ccgccgctac tgctgccgcc aacaccatcc ttggaatggg ctattacgga
 241 agcatcgttg ccaattccag ttcctctaat aacccttcaa ccctggctga ggacaagcta
 301 cttgttctct tggctcagct cgaggcctta acccaacgct taggcgaact gtctaagcag
 361 gtggcccagt tgcgtgagca aactgagtct gctgttgcca cagcaaagtc taaataa
//