LOCUS AY737798 1761 bp DNA linear VRL 30-AUG-2005
DEFINITION Human adenovirus type 50 strain Wan, complete genome.
ACCESSION AY737798 REGION: 12052..13812
VERSION AY737798.1 GI:57115702
KEYWORDS .
SOURCE Human adenovirus 50
 ORGANISM Human adenovirus 50
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 1761)
 AUTHORS Tibbetts,C., Purkayastha,A., Clark,J., Helber,S., Rowley,R.,
 Hanson,E. and Seto,D.
 CONSRTM Epidemic Outbreak Surveillance (EOS)
 TITLE The complete nucleotide sequence and genome organization of Human
 Adenovirus Serotype 50
 JOURNAL Unpublished
REFERENCE 2 (bases 1 to 1761)
 AUTHORS Tibbetts,C., Purkayastha,A., Clark,J., Helber,S., Rowley,R.,
 Hanson,E. and Seto,D.
 CONSRTM Epidemic Outbreak Surveillance (EOS)
 TITLE Direct Submission
 JOURNAL Submitted (30-AUG-2004) Modernization Directorate (SGR), USAF
  Surgeon General Office HQ, 5201 Leesburg Pike, Suite 1401, Falls
 Church, VA 22041, USA
FEATURES Location/Qualifiers
 source 1..1761
 /organism="Human adenovirus 50"
 /mol_type="genomic DNA"
 /strain="Wan; ATCC VR-1502"
 /serotype="50"
 /db_xref="ATCC:VR-1502"
 /db_xref="taxon:107462"
 gene complement(<1..>1761)
 /gene="E2B"
 gene <1..>1761
 /gene="L1"
 CDS 1..1761
  /gene="L1"
 /codon_start=1
 /product="protein IIIa precursor"
 /protein_id="AAW33524.1"
  /db_xref="GI:57115718"
 /translation="MEQQAPDPAKRAALQSQPSGINSSDDWSQAMQRIMALTTRNPEA
 FRQQPQANRLSAILEAVVPSRSNPTHEKVLAIVNALVENKAIRPDEAGLVYNALLERV
 ARYNSSNVQTNLDRMVTDVREAVSQRERFQRDANLGSLVALNAFLSTQPANVPRGQQD
 YTNFLSALRLMVAEVPQSEVYQSGPDYFFQTSRQGLQTVNLSQAFKNLNGLWGVRAPV
 GDRATVSSLLTPNSRLLLLLVAPFTDSGSIDRNSYLGYLLNLYREAIGQTQVDEQTYQ
 EITQVSRALGREDTGSLEATLNFLLTNRSQKIPPQYSLTAEEERILRYVQQSVGLFLM
 QEGATPTAALDMTARNMEPSMYASNRPFINKLLDYLHRAAAMNSDYFTNAILNPHWLP
 PPGFYTGEYDMPDPNDGFLWDDVDSSVFSPPPGYNTWKKEGGDRRHSSVSLSGATGAA
 AAPEAASPFPSLPFSLNSVRSSELGRITRPRLIGEEEYLNDSLLRPEREKNFPNNGIE
  SLVDKMNRWKTYAHDHRDDPRALGDSRGIATRKRQWHDRQRGLVWADDDSADDSSVLD
 LGGSGGNPFAHLRPRVGRLM"
ORIGIN 
 1 atggaacagc aggcaccgga ccccgcaaaa cgggcggcgc tacagagcca gccgtccggc
 61 attaactcct cggacgattg gagccaggcc atgcaacgca tcatggcgct gacgacccgc
 121 aaccccgaag cctttagaca gcaaccccag gccaaccgcc tttctgccat cctggaggcc
 181 gtagtgccct cccgctccaa ccccacacac gagaaggtcc tggccatcgt gaacgcgctg
 241 gtggagaaca aagccatacg tcccgatgag gctgggctgg tatacaatgc cctattggag
 301 cgcgtagccc gttacaacag cagcaacgtg cagaccaacc tggaccggat ggtgaccgat
 361 gtgcgcgagg ccgtgtctca gcgcgagcgg ttccagcgag acgccaattt agggtcgctg
 421 gtggctttga acgccttcct cagcactcag cctgccaacg tgcctcgcgg tcagcaagac
 481 tacacaaact ttctaagtgc attgagactc atggtggccg aagtccctca aagcgaagtg
 541 taccagtccg ggccagacta ctttttccag accagcagac agggcttgca gacagtgaac
 601 ctgagccagg cttttaagaa cctgaatggt ctgtggggag tgcgcgcccc agtgggagat
 661 cgggcgaccg tgtctagctt gctgaccccc aactcccgcc tactactgct cttggtagcc
 721 ccattcactg acagcggtag catcgaccgt aattcgtact tgggctatct gttgaacctg
 781 tatcgcgagg ccatagggca aactcaggta gatgagcaaa cctatcaaga aattacccaa
 841 gtgagccgcg ctctgggtcg ggaggacact ggcagcttgg aagccacctt aaacttcttg
 901 ctgaccaacc ggtcgcagaa gatccctcct cagtattcgc ttaccgcgga ggaggaacgg
 961 atcctgagat acgtgcagca gagcgtggga ctgttcctaa tgcaggaggg ggcgactcct
 1021 actgctgcgc tcgatatgac agcccgaaac atggagccca gcatgtatgc cagtaaccgg
 1081 ccttttatca ataaactgct agactactta cacagggcgg ctgctatgaa ctctgattat
 1141 ttcaccaatg ctatcctgaa cccccattgg ctgcccccac ctgggttcta tacgggcgag
 1201 tatgacatgc ccgaccccaa tgacgggttt ttatgggacg atgtggacag tagtgttttc
 1261 tccccgcctc ctggttataa cacttggaag aaggaaggtg gcgatagaag gcactcttcc
 1321 gtgtcactgt ccggagcaac gggtgctgca gcggctcccg aggccgcaag tcctttccct
 1381 agtttgccat tttcgctaaa cagtgtacgc agcagtgagc tgggaagaat aacccgtcct
 1441 cgcttgatcg gcgaggagga gtatttgaac gactccctgt tgagacccga gagggagaag
 1501 aatttcccca acaacgggat agaaagcttg gttgacaaaa tgaaccgctg gaagacgtac
 1561 gcgcacgatc acagggacga tccccgggcg ctgggggata gccggggcat cgctacccgt
 1621 aaacgccagt ggcacgacag gcagcggggc ctggtgtggg ccgatgatga ttccgccgac
 1681 gacagcagcg tgttggactt gggtgggagt ggtggtaacc cgttcgctca cctgcgcccc
 1741 cgcgtcgggc gcctgatgta a
//