LOCUS       AY737798                 231 bp    DNA     linear   VRL 30-AUG-2005
DEFINITION  Human adenovirus type 50 strain Wan, complete genome.
ACCESSION   AY737798 REGION: 17285..17515
VERSION     AY737798.1  GI:57115702
KEYWORDS    .
SOURCE      Human adenovirus 50
  ORGANISM  Human adenovirus 50
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE   1  (bases 1 to 231)
  AUTHORS   Tibbetts,C., Purkayastha,A., Clark,J., Helber,S., Rowley,R.,
            Hanson,E. and Seto,D.
  CONSRTM   Epidemic Outbreak Surveillance (EOS)
  TITLE     The complete nucleotide sequence and genome organization of Human
            Adenovirus Serotype 50
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 231)
  AUTHORS   Tibbetts,C., Purkayastha,A., Clark,J., Helber,S., Rowley,R.,
            Hanson,E. and Seto,D.
  CONSRTM   Epidemic Outbreak Surveillance (EOS)
  TITLE     Direct Submission
  JOURNAL   Submitted (30-AUG-2004) Modernization Directorate (SGR), USAF
            Surgeon General Office HQ, 5201 Leesburg Pike, Suite 1401, Falls
            Church, VA 22041, USA
FEATURES             Location/Qualifiers
     source          1..231
                     /organism="Human adenovirus 50"
                     /mol_type="genomic DNA"
                     /strain="Wan; ATCC VR-1502"
                     /serotype="50"
                     /db_xref="ATCC:VR-1502"
                     /db_xref="taxon:107462"
     gene            <1..>231
                     /gene="L2"
     CDS             1..231
                     /gene="L2"
                     /codon_start=1
                     /product="protein X"
                     /protein_id="AAW33528.1"
                     /db_xref="GI:57115722"
                     /translation="MALTCRLRVPITGYRGRNSRRRRGMLGRGMRRHRRRRAISKRLG
                     GGFLPALIPIIAAAIGAIPGIASVAVQASQRH"
ORIGIN      
        1 atggccctca cttgccgcct tcgtgtcccc attactggct accgaggaag aaactcgcgc
       61 cgtagaagag ggatgttggg gcgcggaatg cgacgccaca ggcggcggcg cgctatcagc
      121 aagaggctgg ggggtggctt tctgcctgct ctgatcccca tcatagccgc ggcgatcggg
      181 gcgataccag gcatagcttc cgtggcggtt caggcctcgc agcgccactg a
//