LOCUS AY737798 231 bp DNA linear VRL 30-AUG-2005
DEFINITION Human adenovirus type 50 strain Wan, complete genome.
ACCESSION AY737798 REGION: 17285..17515
VERSION AY737798.1 GI:57115702
KEYWORDS .
SOURCE Human adenovirus 50
ORGANISM Human adenovirus 50
Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 231)
AUTHORS Tibbetts,C., Purkayastha,A., Clark,J., Helber,S., Rowley,R.,
Hanson,E. and Seto,D.
CONSRTM Epidemic Outbreak Surveillance (EOS)
TITLE The complete nucleotide sequence and genome organization of Human
Adenovirus Serotype 50
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 231)
AUTHORS Tibbetts,C., Purkayastha,A., Clark,J., Helber,S., Rowley,R.,
Hanson,E. and Seto,D.
CONSRTM Epidemic Outbreak Surveillance (EOS)
TITLE Direct Submission
JOURNAL Submitted (30-AUG-2004) Modernization Directorate (SGR), USAF
Surgeon General Office HQ, 5201 Leesburg Pike, Suite 1401, Falls
Church, VA 22041, USA
FEATURES Location/Qualifiers
source 1..231
/organism="Human adenovirus 50"
/mol_type="genomic DNA"
/strain="Wan; ATCC VR-1502"
/serotype="50"
/db_xref="ATCC:VR-1502"
/db_xref="taxon:107462"
gene <1..>231
/gene="L2"
CDS 1..231
/gene="L2"
/codon_start=1
/product="protein X"
/protein_id="AAW33528.1"
/db_xref="GI:57115722"
/translation="MALTCRLRVPITGYRGRNSRRRRGMLGRGMRRHRRRRAISKRLG
GGFLPALIPIIAAAIGAIPGIASVAVQASQRH"
ORIGIN
1 atggccctca cttgccgcct tcgtgtcccc attactggct accgaggaag aaactcgcgc
61 cgtagaagag ggatgttggg gcgcggaatg cgacgccaca ggcggcggcg cgctatcagc
121 aagaggctgg ggggtggctt tctgcctgct ctgatcccca tcatagccgc ggcgatcggg
181 gcgataccag gcatagcttc cgtggcggtt caggcctcgc agcgccactg a
//