LOCUS AC_000018 630 bp DNA linear VRL 03-APR-2008
DEFINITION Human adenovirus type 7, complete genome.
ACCESSION AC_000018 REGION: 21507..22136
VERSION AC_000018.1 GI:56160876
KEYWORDS .
SOURCE Human adenovirus 7
 ORGANISM Human adenovirus 7
  Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 630)
 AUTHORS Kovacs,G.M., Davison,A.J., Zakhartchouk,A.N. and Harrach,B.
 TITLE Analysis of the first complete genome sequence of an Old World
  monkey adenovirus reveals a lineage distinct from the six human
 adenovirus species
 JOURNAL J. Gen. Virol. 85 (Pt 10), 2799-2807 (2004)
 PUBMED 15448340
REFERENCE 2 (bases 1 to 630)
 AUTHORS Kovacs,G.M. and Davison,A.J.
 TITLE Direct Submission
 JOURNAL Submitted (15-APR-2004) MRC Virology Unit, Church Street, Glasgow
 G11 5JR, UK
COMMENT INFERRED REFSEQ: This record is predicted by genome sequence
 analysis and is not yet supported by experimental evidence. The
 reference sequence was derived from BK005235.
 On Oct 3, 2005 this sequence version replaced gi:52788638.
 This record represents an alternative annotation for AY495969. It
 is included in the NCBI RefSeq collection as an alternative to the
 reference sequence NC_004001.
 COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN  PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
 1-35514 AY495969.1 1-35514
FEATURES Location/Qualifiers
 source 1..630
 /organism="Human adenovirus 7"
 /mol_type="genomic DNA"
 /serotype="7"
 /db_xref="taxon:10519"
 /note="Human adenovirus B"
 CDS 1..630
  /codon_start=1
 /product="protease"
 /protein_id="AP_000549.1"
 /db_xref="GI:56160888"
  /translation="MSCGSGNGSSEQELKAIVRDLGCGPYFLGTFDKRFPGFMAPDKL
 ACAIVNTAGRETGGEHWLAFGWNPRSNTCYLFDPFGFSDERLKQIYQFEYEGLLRRSA
 LATKDRCITLEKSTQSVQGPRSAACGLFCCMFLHAFVHWPDRPMNGNPTMKLLTGVPN
 SMLQSPQVQPTLRRNQEALYRFLNTHSSYFRSHRARIERATAFDRMDMQ"
ORIGIN 
 1 atgtcatgcg ggtccggaaa cggctccagc gagcaagagc tcaaagccat cgtccgagac
 61 ctgggttgcg gaccctattt cctgggaacc tttgacaagc gtttcccggg gttcatggcc
 121 cccgacaagc tcgcctgcgc catagtcaac actgccggac gcgagacggg gggagagcac
 181 tggctggctt ttggttggaa cccgcgctcc aacacctgct acctttttga tccttttggg
 241 ttctcggatg agcgactcaa acagatttac cagtttgagt acgaggggct cctgcgccgc
 301 agtgcccttg ctaccaaaga ccgctgcatc accctggaaa agtccaccca gagcgtgcag
  361 ggcccacgct cagccgcctg tggacttttt tgctgtatgt tccttcatgc ctttgtgcac
 421 tggcccgacc gccccatgaa cggaaacccc accatgaagt tgctgactgg ggtgcccaac
 481 agcatgctcc aatctcccca agtgcagccc accctgcgcc gcaaccagga ggcgctatat
 541 cgcttcctaa acacccactc atcttacttt cgttctcacc gcgcacgcat cgaaagggcc
 601 accgcgtttg accgtatgga tatgcaataa
//