LOCUS AC_000018 1170 bp DNA linear VRL 03-APR-2008
DEFINITION Human adenovirus type 7, complete genome.
ACCESSION AC_000018 REGION: 11105..12274
VERSION AC_000018.1 GI:56160876
KEYWORDS .
SOURCE Human adenovirus 7
 ORGANISM Human adenovirus 7
  Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 1170)
 AUTHORS Kovacs,G.M., Davison,A.J., Zakhartchouk,A.N. and Harrach,B.
 TITLE Analysis of the first complete genome sequence of an Old World
  monkey adenovirus reveals a lineage distinct from the six human
 adenovirus species
 JOURNAL J. Gen. Virol. 85 (Pt 10), 2799-2807 (2004)
 PUBMED 15448340
REFERENCE 2 (bases 1 to 1170)
 AUTHORS Kovacs,G.M. and Davison,A.J.
 TITLE Direct Submission
 JOURNAL Submitted (15-APR-2004) MRC Virology Unit, Church Street, Glasgow
 G11 5JR, UK
COMMENT INFERRED REFSEQ: This record is predicted by genome sequence
 analysis and is not yet supported by experimental evidence. The
 reference sequence was derived from BK005235.
 On Oct 3, 2005 this sequence version replaced gi:52788638.
 This record represents an alternative annotation for AY495969. It
 is included in the NCBI RefSeq collection as an alternative to the
 reference sequence NC_004001.
 COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN  COMP
 1-35514 AY495969.1 1-35514
FEATURES Location/Qualifiers
 source 1..1170
 /organism="Human adenovirus 7"
 /mol_type="genomic DNA"
 /serotype="7"
 /db_xref="taxon:10519"
 /note="Human adenovirus B"
 repeat_region <1..208
 /rpt_unit_range=10769..11040
 CDS 1..1170
 /codon_start=1
 /product="52K"
 /protein_id="AP_000541.1"
 /db_xref="GI:56160882"
 /translation="MHPVLRQMRPQQQPPSQQQLQQQPQKALPAPVTTAAAAVSGAGQ
 PAYDLELEEGEGLARLGAPSPERHPRVQLKKDSREAYVPQQNLFRDRSGEEPEEMRAS
 RFNAGRELRHGLDRRRVLQDEDFEVDEVTGISPARAHVAAANLVSAYEQTVKEERNFQ
 KSFNNHVRTLIAREEVTLGLMHLWDLMEAITQNPTSKPLTAQLFLVVQHSRDNEAFRE
 ALLNITEPDGRWLYDLINILQSIIVQERSLGLAEKVAAINYSVLSLGKYYARKIYKTP
 YVPIDKEVKIDGFYMRMTLKVLTLSDDLGVYRNDRMHRAVSASRRRELSDRELMHSLQ
 RALTGAGTDGENYFDMGADLQWQPSRRAMEAAGCELPYIEEVDEVEDEEGEYLED"
ORIGIN 
 1 atgcatcccg tgctgcgaca gatgcgcccc cagcaacagc ccccttctca gcagcagcta
 61 caacaacagc cacaaaaggc tcttcctgct cctgtaacta ctgcggctgc agccgtcagc
 121 ggcgcgggac agcccgccta tgatctggaa ttggaagagg gcgagggact ggcgcgcctg
 181 ggcgcaccat cgcccgagcg gcacccgcgg gtgcaactga aaaaggactc tcgcgaggcg
 241 tacgtgcccc agcagaacct gttcagggac aggagcggtg aggagccaga ggagatgcga
 301 gcatctcgat ttaacgcggg tcgcgagctg cgccacggtc tggatcgaag acgggtgctg
 361 caagacgagg attttgaggt cgatgaagtg acagggatca gcccagctag ggcacatgtg
 421 gccgcggcca acctagtctc agcctacgag cagaccgtga aggaggagcg caacttccaa
 481 aaatctttta acaaccatgt gcgcaccctg atcgcccgcg aggaagtgac cctgggtctg
 541 atgcatctgt gggacctgat ggaggctatc acccagaacc ccactagcaa accactgaca
 601 gctcagctgt ttctggtggt tcaacatagc agggacaacg aggcattcag ggaggcgttg
 661 ttgaacatca ccgagcctga tgggagatgg ctgtatgatc tgatcaacat cctgcaaagt
 721 attatagtgc aggaacgtag cctgggtttg gctgagaaag tggcagctat caactactcg
 781 gtcttgagcc tgggcaaata ctacgctcgc aagatctaca agacccccta cgtacccata
 841 gataaggagg taaagataga tgggttttac atgcgcatga ctctgaaggt gctgactctg
 901 agcgacgatc tgggggtgta tcgcaatgac aggatgcacc gcgcggtgag cgccagcagg
 961 aggcgcgagc tgagcgacag agaacttatg cacagcttgc aaagagctct aacgggggcc
 1021 gggactgatg gggagaacta ctttgacatg ggagcggact tgcaatggca acccagtcgc
 1081 agggccatgg aggctgcagg gtgtgagctt ccttacatag aagaggtgga tgaagtcgag
 1141 gacgaggagg gcgagtactt ggaagactga
//