LOCUS AC_000018 786 bp DNA linear VRL 03-APR-2008
DEFINITION Human adenovirus type 7, complete genome.
ACCESSION AC_000018 REGION: join(576..1155,1250..1455)
VERSION AC_000018.1 GI:56160876
KEYWORDS .
SOURCE Human adenovirus 7
 ORGANISM Human adenovirus 7
 Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 786)
 AUTHORS Kovacs,G.M., Davison,A.J., Zakhartchouk,A.N. and Harrach,B.
 TITLE Analysis of the first complete genome sequence of an Old World
 monkey adenovirus reveals a lineage distinct from the six human
 adenovirus species
 JOURNAL J. Gen. Virol. 85 (Pt 10), 2799-2807 (2004)
 PUBMED 15448340
REFERENCE 2 (bases 1 to 786)
 AUTHORS Kovacs,G.M. and Davison,A.J.
 TITLE Direct Submission
 JOURNAL Submitted (15-APR-2004) MRC Virology Unit, Church Street, Glasgow
 G11 5JR, UK
COMMENT INFERRED REFSEQ: This record is predicted by genome sequence
 analysis and is not yet supported by experimental evidence. The
 reference sequence was derived from BK005235.
 On Oct 3, 2005 this sequence version replaced gi:52788638.
 This record represents an alternative annotation for AY495969. It
 is included in the NCBI RefSeq collection as an alternative to the
 reference sequence NC_004001.
 COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
 1-35514  AY495969.1 1-35514
FEATURES Location/Qualifiers
 source 1..786
 /organism="Human adenovirus 7"
 /mol_type="genomic DNA"
 /serotype="7"
  /db_xref="taxon:10519"
 /note="Human adenovirus B"
 CDS 1..786
 /codon_start=1
 /product="E1A"
 /protein_id="AP_000534.1"
 /db_xref="GI:56160877"
 /translation="MRHLRFLPQEIIFSETGIEILEFVVNTLMGDDPEPPVQPFDPPT
  LHDLYDLEVDGPQDPNEEAVNGFFTDSMLLAADEGLDINPPPETLVTPGVVVESGRGG
 KKLPDLGAAEMDLRCYEEGFPPSDDEDGETEQSIHTAVNEGVKAASDVFKLDCPELPG
 HGCKSCEFHRNNTGMKELLCSLCYMRMHCHFIYSPVSDDESPSPDSTTSPPEIQAPAP
 ANVCKPIPVKPKPGKRPAVDKLEDLLEGGDGPLDLSTRKLPRQ"
ORIGIN 
 1 atgagacacc tgcgtttcct gccacaggag attatcttca gtgagaccgg gatcgaaata
 61 ctggagtttg tggtaaatac cctaatggga gacgacccgg aaccgccagt gcagcctttc
 121 gatccaccta cgctgcacga tctgtatgat ttagaggtag acgggcctca ggatcccaat
 181 gaggaagctg tgaatgggtt ttttactgat tctatgctgc tagctgccga tgaaggattg
 241 gacataaacc ctcctcctga gacccttgtt accccagggg tggttgtgga aagcggcaga
 301 ggtgggaaaa aattgcctga tctgggagca gctgaaatgg acttgcgttg ttatgaagag
 361 ggttttcctc cgagtgatga tgaagatggg gaaactgagc agtccatcca taccgcagtg
 421 aatgagggag taaaagctgc cagcgatgtt tttaagttgg actgtccgga gctgcctgga
 481 catggctgta agtcttgtga atttcacagg aataacactg gaatgaaaga actattgtgc
 541 tcgctttgct atatgagaat gcactgccac tttatttaca gtcctgtgtc tgatgatgag
 601 tcaccttctc ctgattcaac tacctcacct cctgaaattc aggcgcccgc acctgcaaac
 661 gtatgcaagc ccattcctgt aaagcctaag cctgggaaac gccctgctgt ggataagctt
 721 gaggacttgt tggagggtgg ggatggacct ttggacctta gtacccggaa actgccaagg
 781 caataa
//