LOCUS AC_000018 579 bp DNA linear VRL 03-APR-2008
DEFINITION Human adenovirus type 7, complete genome.
ACCESSION AC_000018 REGION: 15797..16375
VERSION AC_000018.1 GI:56160876
KEYWORDS .
SOURCE Human adenovirus 7
 ORGANISM Human adenovirus 7
  Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE 1 (bases 1 to 579)
 AUTHORS Kovacs,G.M., Davison,A.J., Zakhartchouk,A.N. and Harrach,B.
 TITLE Analysis of the first complete genome sequence of an Old World
  monkey adenovirus reveals a lineage distinct from the six human
 adenovirus species
 JOURNAL J. Gen. Virol. 85 (Pt 10), 2799-2807 (2004)
 PUBMED 15448340
REFERENCE 2 (bases 1 to 579)
 AUTHORS Kovacs,G.M. and Davison,A.J.
 TITLE Direct Submission
 JOURNAL Submitted (15-APR-2004) MRC Virology Unit, Church Street, Glasgow
 G11 5JR, UK
COMMENT INFERRED REFSEQ: This record is predicted by genome sequence
 analysis and is not yet supported by experimental evidence. The
 reference sequence was derived from BK005235.
 On Oct 3, 2005 this sequence version replaced gi:52788638.
 This record represents an alternative annotation for AY495969. It
 is included in the NCBI RefSeq collection as an alternative to the
 reference sequence NC_004001.
 COMPLETENESS: full length.
PRIMARY REFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP
 1-35514 AY495969.1 1-35514
FEATURES Location/Qualifiers
 source 1..579
 /organism="Human adenovirus 7"
 /mol_type="genomic DNA"
 /serotype="7"
 /db_xref="taxon:10519"
 /note="Human adenovirus B"
 CDS 1..579
 /codon_start=1
  /product="pVII"
 /protein_id="AP_000544.1"
 /db_xref="GI:56160884"
 /translation="MSILISPSNNTGWGLYAPTKMYGGARKRSTQHPVRVRGHFRAPW
 GALKGRTRTRTTVDDVIDQVVADARNYTPTAPTSTVDAVIDSVVADARAYARRKSRRR
 RIARRHRATPAMRAAKAILRRAKRVGRRAMLRAARRAASGASSGRSRRRAATAAAAAI
 ANMAQPRRGNVYWVRDATTGQRVPVRTRPPRT"
ORIGIN 
  1 atgtccattc tcatctcgcc cagtaataat accggttggg gactgtatgc gcccaccaag
 61 atgtatggag gcgcccgcaa acgctctacc cagcaccctg tgcgcgttcg cggtcatttc
 121 cgcgctccct ggggcgcact caagggtcgt acccgcactc ggaccacggt cgatgatgtg
 181 atcgaccagg tggtcgccga tgctcgtaat tatactccta ctgcgcctac atctactgtg
 241 gatgcagtta ttgacagtgt ggtggcagac gcccgcgcct atgctcgccg gaagagccga
 301 aggaggcgca tcgccaggcg ccacagggct actcccgcca tgcgagctgc aaaagctatt
 361 ctgcggaggg ccaaacgtgt ggggcgaaga gccatgctta gagcggccag acgcgcggct
 421 tcaggtgcca gcagcggcag gtcccgcagg cgcgcggcca cggcggcagc agcggccatt
 481 gccaacatgg cccaaccgcg aagaggcaat gtgtactggg tgcgtgatgc cactaccggc
 541 cagcgcgtgc ccgtgcgcac tcgcccccct cgcacttag
//