LOCUS       AC_000010                417 bp    DNA     linear   VRL 03-APR-2008
DEFINITION  Simian adenovirus 21, complete genome.
ACCESSION   AC_000010 REGION: 3504..3920
VERSION     AC_000010.1  GI:56160595
KEYWORDS    .
SOURCE      Simian adenovirus 21 (SAdV-21)
  ORGANISM  Simian adenovirus 21
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE   1  (bases 1 to 417)
  AUTHORS   Davison,A.J., Benko,M. and Harrach,B.
  TITLE     Genetic content and evolution of adenoviruses
  JOURNAL   J. Gen. Virol. 84 (Pt 11), 2895-2908 (2003)
   PUBMED   14573794
REFERENCE   2  (bases 1 to 417)
  AUTHORS   Davison,A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAY-2002) MRC Virology Unit, Church Street, Glasgow
            G11 5JR, U.K.
COMMENT     INFERRED REFSEQ: This record is predicted by genome sequence
            analysis and is not yet supported by experimental evidence. The
            reference sequence was derived from BK000412.
            On Oct 3, 2005 this sequence version replaced gi:33694763.
            This record represents an alternative annotation for AR101858. It
            is included in the NCBI RefSeq collection as an alternative to the
            reference sequence NC_004001.
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-35524             AR101858.1         1-35524
FEATURES             Location/Qualifiers
     source          1..417
                     /organism="Simian adenovirus 21"
                     /mol_type="genomic DNA"
                     /serotype="Simian adenovirus 21"
                     /db_xref="taxon:198503"
                     /note="Human adenovirus B"
     CDS             1..417
                     /codon_start=1
                     /product="IX"
                     /protein_id="AP_000264.1"
                     /db_xref="GI:56160599"
                     /translation="MSGSASFEGGVFSPYLTGRLPPWAGVRQNVMGSTVDGRPVQPAN
                     SSTLTYATLSSSPLDAAAAAAASAAANTVLGIGYYGSIVANTSSSNNPSTLAEDKLLV
                     LLAQLEALTQRLGELSQQVAQLREQTESAVATAKSK"
ORIGIN      
        1 atgagtggaa gcgcttcttt tgagggggga gtctttagcc cttatctgac gggccgtctc
       61 ccaccatggg caggagttcg tcagaatgtc atgggatcca ctgtggatgg gagaccagtc
      121 cagcccgcca attcatcaac actgacctat gccactttga gctcttcacc cttggatgca
      181 gctgcagctg ctgccgcttc tgctgccgcc aataccgtcc ttggaattgg ctattatgga
      241 agcatcgttg ccaataccag ttcctcaaat aacccttcga ccctggctga ggacaagcta
      301 cttgttcttt tggcgcagct tgaggcgttg acccagcgcc tgggtgaact gtctcagcag
      361 gtggcccagc tgcgcgagca aactgagtct gctgttgcca cagcaaagtc taaataa
//