LOCUS       AC_000010                231 bp    DNA     linear   VRL 03-APR-2008
DEFINITION  Simian adenovirus 21, complete genome.
ACCESSION   AC_000010 REGION: 17338..17568
VERSION     AC_000010.1  GI:56160595
KEYWORDS    .
SOURCE      Simian adenovirus 21 (SAdV-21)
  ORGANISM  Simian adenovirus 21
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus.
REFERENCE   1  (bases 1 to 231)
  AUTHORS   Davison,A.J., Benko,M. and Harrach,B.
  TITLE     Genetic content and evolution of adenoviruses
  JOURNAL   J. Gen. Virol. 84 (Pt 11), 2895-2908 (2003)
   PUBMED   14573794
REFERENCE   2  (bases 1 to 231)
  AUTHORS   Davison,A.J.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAY-2002) MRC Virology Unit, Church Street, Glasgow
            G11 5JR, U.K.
COMMENT     INFERRED REFSEQ: This record is predicted by genome sequence
            analysis and is not yet supported by experimental evidence. The
            reference sequence was derived from BK000412.
            On Oct 3, 2005 this sequence version replaced gi:33694763.
            This record represents an alternative annotation for AR101858. It
            is included in the NCBI RefSeq collection as an alternative to the
            reference sequence NC_004001.
            COMPLETENESS: full length.
PRIMARY     REFSEQ_SPAN         PRIMARY_IDENTIFIER PRIMARY_SPAN        COMP
            1-35524             AR101858.1         1-35524
FEATURES             Location/Qualifiers
     source          1..231
                     /organism="Simian adenovirus 21"
                     /mol_type="genomic DNA"
                     /serotype="Simian adenovirus 21"
                     /db_xref="taxon:198503"
                     /note="Human adenovirus B"
     CDS             1..231
                     /codon_start=1
                     /product="pX"
                     /protein_id="AP_000273.1"
                     /db_xref="GI:56160608"
                     /translation="MALTCRLRVPITGYRGRNSRRRRGMLGRGMRRHRRRRAISKRLG
                     GGFLPALIPIIAAAIGAIPGIASVAVQASQRH"
ORIGIN      
        1 atggccctca cttgccgcct tcgtgtcccc attactggct accgaggaag aaactcgcgc
       61 cgtagaagag ggatgttggg gcgcgggatg cgacgccaca ggcggcggcg cgctatcagc
      121 aagaggctgg ggggtggctt tctgcctgct ctgatcccca tcatagccgc ggcgatcggg
      181 gcgataccag gcatagcttc cgtggcggtt caggcctcgc agcgccactg a
//