LOCUS       AF534906                1503 bp    DNA     linear   VRL 18-AUG-2004
DEFINITION  Human adenovirus type 1 subgroup C, complete genome.
ACCESSION   AF534906 REGION: 2022..3524
VERSION     AF534906.1  GI:33330439
KEYWORDS    .
SOURCE      Human adenovirus 1
  ORGANISM  Human adenovirus 1
            Viruses; dsDNA viruses, no RNA stage; Adenoviridae; Mastadenovirus;
            Human adenovirus C.
REFERENCE   1  (bases 1 to 1503)
  AUTHORS   Lauer,K.P., Llorente,I., Blair,E., Seto,J., Krasnov,V.,
            Purkayastha,A., Ditty,S.E., Hadfield,T.L., Buck,C., Tibbetts,C. and
            Seto,D.
  TITLE     Natural variation among human adenoviruses: genome sequence and
            annotation of human adenovirus serotype 1
  JOURNAL   J. Gen. Virol. 85 (Pt 9), 2615-2625 (2004)
   PUBMED   15302955
REFERENCE   2  (bases 1 to 1503)
  AUTHORS   Seto,D.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-AUG-2002) Biomedical Genomics and Informatics, George
            Mason University, 10900 University Blvd, Manassas, VA 20110, USA
FEATURES             Location/Qualifiers
     source          1..1503
                     /organism="Human adenovirus 1"
                     /virion
                     /mol_type="genomic DNA"
                     /db_xref="taxon:10533"
                     /note="subgroup: C"
     gene            <1..238
                     /gene="E1a"
     CDS             <1..238
                     /gene="E1a"
                     /codon_start=1
                     /product="21 kDa protein"
                     /protein_id="AAQ10539.1"
                     /db_xref="GI:33330441"
                     /translation="MEAWECLEDFSAVRNLLEQSSNSTSWFWRFLWGSSQAKLVCRIK
                     EDYKWEFEELLKSCGELFDSLNLGHQALFQEKVIKTLDFSTPGRAAAAVAFLSFIKDK
                     WSEETHLSGGYLLDFLAMHLWRAVVRHKNRLLLLSSVRPAIIPTEEQQQQQQQQEEAR
                     RRRRQEQSPWNPRAGLDPRE"
     gene            1..1503
                     /gene="E1b"
     CDS             1..1503
                     /gene="E1b"
                     /codon_start=1
                     /product="transformation-associated protein 55 kDa"
                     /protein_id="AAQ10566.1"
                     /db_xref="GI:33330468"
                     /translation="MERRNPSERGVPAGFSGHAFVESGGETQESPTTVVFRPPGNNTD
                     GGAAAATAAAGGSQAAAAAGAEPMEPESRPGPSGMNVVQVAELFPELRRILTINEDGQ
                     GLKGVKRERGAFEATEEVRNLTFSLMTRHRPECVTFQQIKDNCANELDLLAQKYSIEQ
                     LTTYWLQPGDDFEEAIRVYAKVALRPDCKYKISKLVNIRNCCYISGNGAEVEIDTEDR
                     VAFRCSMINMWPGVLGMDGVVIMNVRFTGPNFSGTVFLANTNLILHGVSFYGFNNTCV
                     EAWTDVRVRGCAFYCCWKGVVCRPKSRASIKKCLFERCTLGILSEGNSRVRHNVASDC
                     GCFMLVKSVAVIKHNMVCGNCEDRASQMLTCSDGNCHLLKTIHVASHSRKAWPVFEHN
                     ILTRCSLHLGNRRGVFLPYQCNLSHTKILLEPESMSKVNLNGVFDMTMKIWKVLRYDE
                     TRTRCRPCECGGKHIRNQPVMLDVTEELRPDHLVLACTRAEFGSSDEDTD"
     CDS             join(1..249,1270..1503)
                     /gene="E1b"
                     /note="derived from 1.26 kB mRNA"
                     /codon_start=1
                     /product="E1b"
                     /protein_id="AAQ10565.1"
                     /db_xref="GI:33330467"
                     /translation="MERRNPSERGVPAGFSGHAFVESGGETQESPTTVVFRPPGNNTD
                     GGAAAATAAAGGSQAAAAAGAEPMEPESRPGPSGMNVVQPESMSKVNLNGVFDMTMKI
                     WKVLRYDETRTRCRPCECGGKHIRNQPVMLDVTEELRPDHLVLACTRAEFGSSDEDTD"
     CDS             join(1..249,1212..1256)
                     /gene="E1b"
                     /note="derived from 1.31 kb mRNA"
                     /codon_start=1
                     /product="E1b"
                     /protein_id="AAQ10540.1"
                     /db_xref="GI:33330442"
                     /translation="MERRNPSERGVPAGFSGHAFVESGGETQESPTTVVFRPPGNNTD
                     GGAAAATAAAGGSQAAAAAGAEPMEPESRPGPSGMNVVQEGGVPTLPMQFESH"
ORIGIN      
        1 atggagcgaa gaaacccatc tgagcggggg gtacctgctg gattttctgg ccatgcattt
       61 gtggagagcg gtggtgagac acaagaatcg cctactactg ttgtcttccg tccgcccggc
      121 aataataccg acggaggagc agcagcagca acagcagcag caggaggaag ccaggcggcg
      181 gcggcggcag gagcagagcc catggaaccc gagagccggc ctggaccctc gggaatgaat
      241 gttgtacagg tggctgaact gtttccagaa ctgagacgca ttttaacaat taacgaggat
      301 gggcaggggc taaagggggt aaagagggag cggggggctt ttgaggctac agaggaggtt
      361 aggaatttaa cttttagctt aatgaccaga caccgtcctg agtgtgttac ttttcagcag
      421 attaaggata attgcgctaa tgagcttgat ctgctggcgc agaagtattc catagagcag
      481 ctgaccactt actggctgca gccaggggat gattttgagg aggctattag ggtatatgca
      541 aaggtggcac ttaggccaga ttgcaagtac aagattagca aacttgtaaa tattaggaat
      601 tgttgctaca tttctgggaa cggggccgag gtggagatag atacggagga tagggtggcc
      661 tttagatgta gcatgataaa tatgtggccg ggggtacttg gcatggacgg ggtggttatt
      721 atgaatgtga ggtttactgg ccccaatttt agcggtacgg ttttcctggc caataccaac
      781 cttatcctac acggtgtaag cttctatggg tttaacaata cctgcgtgga agcctggacc
      841 gatgtaaggg ttcgaggctg tgccttttac tgctgctgga agggggtggt gtgtcgcccc
      901 aaaagcaggg cttcaattaa gaaatgcctc tttgaaaggt gtaccttggg tatcctgtct
      961 gagggtaact ccagggtgcg ccacaatgtg gcctccgact gtggttgctt catgctagtg
     1021 aaaagcgtgg ctgtgattaa gcataacatg gtgtgtggca actgcgagga cagggcctct
     1081 cagatgctaa cctgctcgga cggcaactgt cacctgctga agaccattca cgtagccagc
     1141 cactctcgca aggcctggcc agtgtttgag cacaacatac tgacccgctg ttccttgcat
     1201 ttgggtaaca ggaggggggt gttcctacct taccaatgca atttgagtca cactaagata
     1261 ttgcttgagc ccgaaagcat gtccaaggtg aacctgaacg gggtgtttga catgaccatg
     1321 aagatctgga aggtgctgag gtacgatgag acccgcacca ggtgcagacc ctgcgagtgt
     1381 ggcggtaaac atattaggaa ccagcctgtg atgctggatg tgaccgagga gctgaggccc
     1441 gatcacttgg tgctggcctg cacccgcgct gagtttggct ctagcgatga agatacagat
     1501 tga
//